ESTScan Details for Unigene SGN-U329167

Score 
404
Direction 
Forward
Predicted Peptide Sequence 
MAQMKVVMKVLTMSDEKTKQKAIEAAADILGVDSIAADLKEQKLTVIGEMDAVAVVKKLKKAVGKVDILSVGPAKEE
Predicted Coding Sequence 
ATGGCTCAGATGAAAGTTGTAATGAAGGTGCTAACCATGTCTGATGAAAAAACAAAGCAGAAAGCCATAGAAGCTGCAGCTGATATTTTA
GGTGTAGATTCAATAGCAGCAGATCTAAAGGAGCAAAAATTGACAGTTATAGGGGAAATGGATGCAGTTGCAGTGGTGAAGAAATTGAAA
AAAGCTGTTGGTAAAGTAGATATATTATCAGTGGGACCAGCTAAGGAAGAG
Edits in Original Sequence 
GTTCTCCAAAA(5')ATGGCTCAGATGAAAGTTGTAATGAAGGTGCTAACCATGTCTGATGAAAAAACAAAGCAGAAAGCCATAGAAGCT
GCAGCTGATATTTTAGGTGTAGATTCAATAGCAGCAGATCTAAAGGAGCAAAAATTGACAGTTATAGGGGAAATGGATGCAGTTGCAGTG
GTGAAGAAATTGAAAAAAGCTGTTGGTAAAGTAGATATATTATCAGTGGGACCAGCTAAGGAAGAG(3')AAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan