ESTScan Details for Unigene SGN-U329188

Score 
284
Direction 
Forward
Predicted Peptide Sequence 
LKFISELNEEAKHLLECALMEANKEREKNILKGTTYSPPSPTNSDNGMDDNISEVKKQKFVVYASIKYARFRSRTAGTRCVHIVYWRYAX
HKKPNPTTTSPIAPGAHSVEATXVQLDVIKLEKDDGTSHDIVSPSKLRKFRRSRNFSEGSSSFKGLFAVTFFGRMVGRGFGRIAAENEYI
DKPIILD
Predicted Coding Sequence 
XXATTGAAATTCATCAGTGAGCTGAATGAAGAGGCAAAACATTTGCTGGAATGTGCACTCATGGAGGCTAACAAAGAGAGGGAAAAGAAC
ATCCTGAAAGGAACAACTTATTCGCCACCATCGCCAACCAATTCCGATAATGGGATGGATGACAACATCTCTGAGGTCAAGAAACAGAAA
TTTGTTGTATATGCTTCGATCAAGTATGCACGATTCAGGTCCAGGACTGCGGGCACCAGATGTGTGCACATTGTGTACTGGCGTTATGCT
GXTCATAAAAAGCCTAATCCTACTACTACCAGTCCTATTGCACCTGGTGCCCATTCTGTTGAAGCAACAXTTGTTCAATTAGATGTTATC
AAGCTGGAAAAGGACGATGGAACTAGCCACGATATTGTTTCCCCCTCAAAGCTTAGGAAGTTTAGGCGATCAAGAAACTTCAGCGAGGGG
AGTAGCAGTTTTAAGGGCTTATTTGCAGTAACCTTTTTTGGAAGAATGGTTGGTCGTGGCTTTGGTAGAATTGCTGCTGAAAACGAATAC
ATTGATAAGCCAATAATCCTTGACTAA
Edits in Original Sequence 
(5')XXATTGAAATTCATCAGTGAGCTGAATGAAGAGGCAAAACATTTGCTGGAATGTGCACTCATGGAGGCTAACAAAGAGAGGGAAAA
GAACATCCTGAAAGGAACAACTTATTCGCCACCATCGCCAACCAATTCCGATAATGGGATGGATGACAACATCTCTGAGGTCAAcGAAAC
AGAAATTTGTTGTATATGCTTCGATCAAGTATGCACGATTCAGGTCCAGGACTGCGGGCACCAGATGTGTGCACATTGTGTACTGGCGTT
ATGCTGXTCATAAAAAGCCTAATCCTACTACTACCAGTCCTATTGCACCTGtGTGCCCATTCTGTTGAAGCAACAXTTGTTCAATTAGAT
GTTATCAAGCTGGAAAAGGACGATGGAACTAGCCACGATATTGTTTCCCCCTCAAAGCTTAGGAAGTTTAGGCGATCAAGAAACTTCAGC
GAGGGGAGTAGCAGTTTTAAGGGCTTATTTGCAGTAACCTTTTTTGGAAGAATGGTTGGTCGTGGCTTTGGTAGAATTGCTGCTGAAAAC
GAATACATTGATAAGCCAATAATCCTTGACTAA(3')TAGCAGAATTTTGCATCAAGACTTCCAATTAGCATGATTTTTTAAGAGCATCC
TAAATGGTATATTGTTACCACATTTTTTTACAGTTGAAATAGAAGGAATTCTTTGACAGTTGCCTCATTTTTTGTTCTGTTTTGTCCTGC
CTGATGAAAATTCAAAAAGGTCTCGATGTGTAATGTTAATATGAACAATCGCCTTAAAAAGATATGAAAGTTTAATAATGTGGAAGAAAA
AAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan