ESTScan Details for Unigene SGN-U329323

Score 
427
Direction 
Forward
Predicted Peptide Sequence 
GTDALSVYVSNVTCNCDTPDGYCHVQSILLKGQDLAGVLPPSLAKLPNLTIIDLSCNYLSGTIPPEWTSMKLETMSLMLNHLSGPIPKYL
GNMTSLVYMRLESNMFNGTVPKELGGMVNLQVLILSFNNLTGQLPEELNKLTNLKELRLRGNNFTGKLPNLESFKTLQRLEIQASGFEGP
ISPIISVSTQMIELRITDLTGGASEFPQLGEYDAPTRLILRNCNLSGKIPPYITKMPKLKLLDLSFNKFEGQIPNLXESKRVGLLVPGGN
RLTGPIPGWX
Predicted Coding Sequence 
XXAGGAACAGACGCTTTGTCAGTGTACGTGAGCAATGTAACCTGCAATTGTGATACCCCTGATGGTTATTGTCATGTACAAAGCATATTA
CTCAAAGGACAAGATCTTGCTGGTGTTCTTCCTCCATCCCTGGCGAAGTTACCAAATCTCACCATAATTGATCTCTCATGCAACTATTTG
AGTGGTACAATTCCCCCTGAATGGACATCGATGAAACTGGAAACCATGTCTCTTATGCTGAATCACCTATCTGGACCAATTCCAAAGTAC
TTAGGAAACATGACTTCACTAGTTTATATGAGATTGGAAAGTAATATGTTTAATGGAACTGTTCCAAAAGAACTCGGAGGCATGGTTAAT
CTACAGGTTCTCATTCTTAGTTTTAATAATCTCACAGGTCAGTTACCAGAGGAGCTCAATAAACTCACTAATTTGAAAGAACTTAGGCTG
AGAGGTAACAACTTCACAGGAAAACTTCCTAACTTAGAGAGTTTTAAAACCCTTCAAAGATTAGAGATTCAAGCTTCTGGTTTTGAAGGA
CCTATATCTCCAATCATTTCTGTCTCAACTCAAATGATCGAATTGAGAATCACTGATTTGACTGGAGGTGCTTCAGAATTTCCACAGCTT
GGXGAATATGACGCGCCAACTAGATTGATATTGAGGAATTGCAATTTATCTGGGAAGATTCCTCCTTACATAACTAAGATGCCTAAATTA
AAACTTTTAGATCTAAGTTTCAACAAGTTTGAAGGACAGATCCCAAATCTTGAXGAGTCTAAAAGAGTTGGACTTCTTGTACCTGGTGGA
AATCGACTTACTGGGCCAATTCCAGGTTGGGXX
Edits in Original Sequence 
(5')XXAGGAACAGACGCTTTGTCAGTGTACGTGAGCAATGTAACCTGCAATTGTGATACCCCTGATGGTTATTGTCATGTACAAAGCAT
ATTACTCAAAGGACAAGATCTTGCTGGTGTTCTTCCTCCATCCCTGGCGAAGTTACCAAATCTCACCATAATTGATCTCTCATGCAACTA
TTTGAGTGGTACAATTCCCCCTGAATGGACATCGATGAAACTGGAAACCATGTCTCTTATGCTGAATCACCTATCTGGACCAATTCCAAA
GTACTTAGGAAACATGACTTCACTAGTTTATATGAGATTGGAAAGTAATATGTTTAATGGAACTGTTCCAAAAGAACTCGGAGGCATGGT
TAATCTACAGGTTCTCATTCTTAGTTTTAATAATCTCACAGGTCAGTTACCAGAGGAGCTCAATAAACTCACTAATTTGAAAGAACTTAG
GCTGAGAGGTAACAACTTCACAGGAAAACTTCCTAACTTAGAGAGTTTTAAAACCCTTCAAAGATTAGAGATTCAAGCTTCTGGTTTTGA
AGGACCTATATCTCCAATCATTTCTGTCTCAACTCAAATGATCGAATTGAGAATCACTGATTTGACTGGAGGTGCTTCAGAATTTCCACA
GCTTGGXGAATATGACGCGCCtAACTAGATTGATATTGAGGAATTGCAATTTATCTGGGAAGATTCCTCCTTACATAACTAAGATGCCTA
AATTAAAACTTTTAGATCTAAGTTTCAACAAGTTTGAAGGACAGATCCCAAATCTTGAXGAGTCTAAAAGAGTTGGACTTCTTGTACCTG
GTcGGAAATCGACTTACTGGGCCAATTCCAGGTTGGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan