ESTScan Details for Unigene SGN-U329533

Score 
394
Direction 
Forward
Predicted Peptide Sequence 
LVPKNPLATGSATACGKSASLVAVKFPAAVFGCLRSQTLDYTVCSFIAVAPGISXILKPLFDXTLVKTRLFLKVKSEXMENSNTPASDSN
AAKAEAEQLPTAPVCNFFKKPSKGKNIRKRPTVEEGENEDAEGDSSVIYTKKKPAVANNKLHFSTGPSKSNKDTDSNVDSKAARFHFESS
KEIQVQNDSRATATLETETEFSRDARAIREKALKHAEDALKGKSKTGGDDKLYKGMNQYTDYKSWF
Predicted Coding Sequence 
XXCCTCGTGCCGAAAAACCCTCTTGCCACCGGTTCXGCCACCGCCTGCGGCAAATCCGCCTCTCTTGTCGCCGTGAAGTTTCCTGCTGCG
GTGTTTGGTTGTCTTCGATCTCAAACTCTCGATTATACCGTCTGCTCTTTTATTGCTGTGGCACCTGGAATCTCTAAXATTCTGAAGCCT
CTCTTTGACCXGACTTTGGTGAAAACTCGTCTCTTTCTCAAAGTAAAATCTGAGTTXATGGAGAATTCAAATACTCCAGCATCTGATTCG
AACGCTGCCAAAGCTGAAGCTGAACAGCTGCCAACAGCTCCCGTATGCAATTTTTTCAAAAAACCATCCAAGGGAAAAAATATCAGAAAG
CGTCCTACAGTTGAAGAGGGAGAGAATGAAGATGCAGAAGGAGATAGTTCAGTCATATATACCAAGAAAAAGCCAGCGGTTGCGAATAAT
AAGCTGCACTTCTCAACTGGACCTTCAAAGTCCAACAAGGATACTGACTCCAATGTAGATTCAAAAGCGGCTCGTTTTCATTTCGAGTCC
TCAAAGGAAATTCAAGTTCAAAATGATAGTAGAGCAACAGCTACTTTAGAAACTGAGACTGAGTTCTCTAGAGATGCCCGGGCCATTCGA
GAAAAAGCTCTGAAGCATGCAGAGGATGCTTTAAAGGGAAAAAGCAAGACAGGTGGTGATGACAAATTGTATAAAGGTATGAATCAATAT
ACTGATTACAAAAGCTGGTTT
Edits in Original Sequence 
(5')XXCCTCGTGCCGAAAAACCCTCTTGCCACCGGTTCXGCCACCGCCTGCGGCAAATCCGCCTCTCTTGTCGCCGTGAAGTTTCCTGc
CTGCGGTGTTTGGTTGTCTTCGATCTCAAACTCTCGATTATACCGTCTGCTCTTTTATTGCTGTGGCACCTGGAATCTCTAAXATTCTGA
AGCCTCTCTTTGACCXGACTTTGGTGAAAtACTCGTCTCTTTCTCAAAGTAAAATCTGAGTTXATGGAGAATTCAAATACTCCAGCATCT
GATTCGAACGCTGCCAAAGCTGAAGCTGAACAGCTGCCAACAGCTCCCGTATGCAATTTTTTCAAAAAACCATCCAAGGGAAAAAATATC
AGAAAGCGTCCTACAGTTGAAGAGGGAGAGAATGAAGATGCAGAAGGAGATAGTTCAGTCATATATACCAAGAAAAAGCCAGCGGTTGCG
AATAATAAGCTGCACTTCTCAACTGGACCTTCAAAGTCCAACAAGGATACTGACTCCAATGTAGATTCAAAAGCGGCTCGTTTTCATTTC
GAGTCCTCAAAGGAAATTCAAGTTCAAAATGATAGTAGAGCAACAGCTACTTTAGAAACTGAGACTGAGTTCTCTAGAGATGCCCGGGCC
ATTCGAGAAAAAGCTCTGAAGCATGCAGAGGATGCTTTAAAGGGAAAAAGCAAGACAGGTGGTGATGACAAATTGTATAAAGGTATGAAT
CAATATACTGATTACAAAAGCTGGTTT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan