ESTScan Details for Unigene SGN-U329738

Score 
398
Direction 
Forward
Predicted Peptide Sequence 
QMEPENPSNYVSLSNLYASSKRWDVVAQVRTMMKDKGLKKFPGCSWISVNTETHSFYVANKSHPCSVVIYEMLDQLILAMKQDDNGVVFE
DTLKVYDEQVTTVXKANLNTQFLPGRIIALEVFLSKQDDAIXQDELMCIIIVAANMTNQELPSQPTPTRLCSYAYNHEELMEVNRSSAEQ
QLVPSVNHQPXDDLFISTSGQRHEGTTMQLSPGLKRSGTGKADVGEKKKSDFKFGAYVWLGGASGDAIHHISPLVTERKRATPCIGCTKL
KEVQACLLPVNQREKRLLAAAADLRDQLSKGLYTXGVQKELRFAEVCESLNYWNLLKLKGETLMY
Predicted Coding Sequence 
XTACAGATGGAACCCGAGAACCCCTCCAATTATGTGTCTCTTTCAAATTTGTATGCTTCTTCAAAGAGATGGGATGTCGTTGCTCAAGTG
AGAACTATGATGAAAGATAAAGGGCTGAAGAAGTTCCCTGGTTGTAGTTGGATTAGCGTTAACACTGAAACTCATAGCTTTTACGTTGCT
AACAAGTCTCATCCTTGTTCTGTTGTGATTTATGAGATGCTAGATCAACTCATCTTAGCAATGAAACAAGATGATAATGGTGTTGTCTTT
GAAGATACTCTGAAGGTTTATGATGAACAAGTTACAACAGTTCXGAAAGCAAATTTGAATACACAATTTCTTCCTGGAAGGATCATTGCA
CTTGAGGTCTTCTTATCGAAGCAGGATGATGCAATTGXTCAAGATGAACTGATGTGTATTATTATTGTTGCAGCTAACATGACCAATCAA
GAGCTGCCCTCCCAGCCTACTCCAACTAGGCTGTGTAGTTATGCTTACAATCATGAAGAGTTGATGGAAGTAAACAGAAGTAGTGCTGAA
CAACAATTAGTGCCAAGTGTTAACCACCAGCCTAAXGATGACCTTTTTATCAGTACATCAGGGCAGAGGCATGAAGGTACAACGATGCAG
CTTAGTCCTGGTCTGAAAAGGAGCGGGACAGGAAAAGCTGATGTTGGTGAAAAAAAGAAGTCXGATTTCAAGTTTGGAGCATATGTGTGG
CTAGGAGGAGCATCTGGGGATGCTATCCACCACATAAGCCCGCTGGTAACAGAGAGAAAGCGAGCAACCCCTTGTATAGGTTGCACGAAG
CTTAAAGAAGTGCAAGCCTGTCTTCTTCCAGTAAATCAAAGAGAAAAACGTCTTCTTGCCGCAGCTGCTGACCTAAGAGACCAACTTAGT
AAGGGGCTCTATACTXCTGGAGTCCAAAAAGAGCTCAGGTTTGCAGAAGTTTGTGAGAGTTTGAACTATTGGAATCTATTGAAACTTAAG
GGAGAAACACTCATGTACTGA
Edits in Original Sequence 
(5')XTACAGATGGAACCCGAGAACCCCTCCAATTATGTGTCTCTTTCAAATTTGTATGCTTCTTCAAAGAGATGGGATGTCGTTGCTCA
AGTGAGAACTATGATGAAAGATAAAGGGCTGAAGAAGTTCCCTGGTTGTAGTTGGATTAGCGTTAACACTGAAACTCATAGCTTTTACGT
TGCTAACAAGTCTCATCCTTGTTCTGTTGTGATTTATGAGATGCTAGATCAACTCATCTTAGCAATGAAACAAGATGATAATGGTGTTGT
CTTTGAAGATACTCTGAAGGTTTATGaATGAACAAGTTACAACAGTTCXGAAAGCAAATTTGAATACACAATTTCTTCCTGGAAGGATCA
TTGCACTTGAGGTCTTCTTATCGAAGCAGGATGATGCAATTGXTCAAGATGAACTGATGTGTATTATTATTGTgTGCAGCTAACATGACC
AATCAAGAGCTGCCCTCCCAGCCTACTCCAACTAGGCTGTGTAGTTATGCTTACAATCATGAAGAGTTGATGGAAGTAAACAGAAGTAGT
GCTGAACAACAATTAGTGCCAAGTGTTAACaCACCAGCCTAAXGATGACCTTTTTATCAGTACATCAGGGCAGAGGCATGAAGGTACAAC
GATGCAGCTTAGTCCTGGTCTGAAAAGGAGCGGGACAGtGAAAAGCTGATGTTGGTGAAAAAAAGAAGTCXGATTTCAAGTTTGGAGCAT
ATGTGTGGCTAGGAGGAGCATCTGGGGATGCTATCCACCACATAAGCCCGCTGGTAACAGAGAGAAAGCGAGCAACCCCTTGTATAGGTT
GCACGAAGCTTAAAGAAGTGCAAGCCTGTCTTCTTCCAGTAAATCAAAGAGAAAAACGTCTaTCTTGCCGCAGCTGCTGACCTAAGAGAC
CAACTTAGTAAGGGGCTCTATACTXCTGGAGTCCAAAAAGAGCTCAGGTTTGCAGAAGTTTGTGAGAGTTTGAACTATTGGAATCTATTG
AAACTTAAGGGAGAAACACTCATGTACTGA(3')ATATGATGGAGAAGTAGCCTATCAATACATTCATTGAATTTCTTGTGTTCAAAAAA
AAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan