ESTScan Details for Unigene SGN-U329765

Score 
340
Direction 
Forward
Predicted Peptide Sequence 
LYLFFCKHSDLDNQGLRGFLPDDVSQLRHLQSINLSGNNIHGLIPSALGTITSLEKLDLSYNSFNGSIPESLGELTSLLTLNLNGNLLSG
KIPAALGGRLLHRASFNFTDNAGLCGIPGLPTCGPHLTIGAKIGIGLGACVAVXSYRYMHNMLVEKAAKYPAAKRMAVRDAPYAEEKNTF
KPHPNDKKPSNGHHHEHTRTAVENGPPLLV
Predicted Coding Sequence 
CTTTATCTGTTTTTCTGTAAGCACAGTGACCTGGACAACCAAGGTTTACGAGGTTTCTTACCAGATGATGTTTCTCAATTGCGTCATCTT
CAGAGCATAAATTTGAGTGGAAACAACATTCACGGGCTTATTCCCTCAGCACTTGGAACAATAACTAGTCTGGAGAAATTGGATCTTTCA
TACAATTCCTTCAACGGATCGATTCCTGAAAGCCTTGGGGAATTGACGTCGTTACTGACACTGAATCTCAACGGCAATTTGCTCTCTGGA
AAAATTCCTGCAGCGTTAGGCGGAAGGCTCTTGCACAGAGCTAGCTTCAATTTTACTGATAATGCAGGCCTTTGTGGTATTCCTGGATTA
CCAACATGTGGACCACATCTTACTATTGGTGCCAAAATCGGCATTGGGTTAGGGGCGTGTGTCGCTGTTGXTAGTTATCGCTACATGCAT
AACATGTTGGTGGAAAAGGCGGCAAAATATCCTGCCGCTAAAAGAATGGCTGTGAGAGACGCTCCTTATGCXGAAGAAAAGAACACATTT
AAACCACATCCAAATGACAAGAAACCATCAAATGGTCATCATCACGAACATACTCGGACAGCTGTTGAGAATGGACCTCCTTTGCTTGTC
TGA
Edits in Original Sequence 
(5')CTTTATCTGTTTTTCTGTAAGCACAGTGACCTGGACAACCAAGGTTTACGAGGTTTCTTACCAGATGATGTTTCTCAATTGCGTCA
TCTTCAGAGCATAAATTTGAGTGGAAACAACATTCACGGGCTTATTCCCTCAGCACTTGGAACAATAACTAGTCTGGAGAAATTGGATCT
TTCATACAATTCCTTCAACGGATCGATTCCTGAAAGCCTTGGGGAATTGACGTCGTTACTGACACTGAATCTCAACGGCAATTTGCTCTC
TGGAAAAATTCCTGCAGCGTTAGGCGGAAGGCTCTTGCACAGAGCTAGCTTCAATTTTACTGATAATGCAGGCCTTTGTGGTATTCCTGG
ATTACCAACATGTGGACCACATCTTACTATTGGTGCCAAAATCGGCATTGGGTTAGGGGCGTGTGTCGCTGTTGXTAGTTATCGCTACAT
GCATAACATGTTGGTGGAAAAGGCGGCAAAATATCCTGCgCGCTAAAAGAATGGCTGTGAGAGACGCTCCTTATGCXGAAGAAAAGAACA
CATTTAAACCACATCCAAATGACAAGAAACCATCAcAATGGTCATCATCACGAACATACTCGGACAGCTGTTGAGAATGGACCTCCTTTG
CTTGTCTGA(3')GTTCGAACAATTTTTGAGTCAACTCACACTAGAAACTTCTTTTGACGTCAAGAGGATTCAACAATCTACAGATATAT
CAACAAAAACATTGTTCGTATCCTACTTACAGAGTGTAATTCTTTGACGAAGGGATGATCATTTGAATCCCATCCGCAGACAATGTAACT
CCATCGCAGGCTTAGTGAGAAGATTTTCAGATACAATGCTGCTGTTTTTTGGCTAGAAAATGTGTATAGTGGTTATACAGATCAGGAATC
AATTACAAATTCCATAGATGTAATTCAGTGCAAGAGACAGTATATGTTGTATATTTTAACTATATACATGTATACTTAATCATTAATTTT
GGAGCTTTTTGGTTAAAGACAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan