Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U329865

Score 
259
Direction 
Forward
Predicted Peptide Sequence 
MTSSAVNLVMTVIGFTVSIIFIVFXVYKVNLCKNSVFDKEEVFCIYFRSDLSILERGLHGLEPLAVSKFPTKKYSDAFFSFAENTQCMIC
LAEYREEDTLRILPLCGHYFHATCIDIWFQQHSTCPVCRISLRETAEKKCFLQPLFSSAVRSQYTMDTLNVNSNNAHHXGLKLSX
Predicted Coding Sequence 
ATGACATCTTCAGCTGTAAATTTGGTGATGACAGTGATTGGGTTTACAGTGAGCATTATATTCATAGTATTTGXTGTGTACAAGGTTAAT
TTGTGCAAGAATTCAGTATTTGACAAGGAGGAGGTCTTCTGCATATACTTCAGATCTGATCTTAGCATTTTGGAACGTGGTTTACATGGG
CTGGAGCCTCTTGCTGTGTCGAAGTTCCCCACGAAGAAGTACAGTGATGCATTTTTTTCATTTGCAGAAAATACTCAATGCATGATTTGC
CTTGCTGAGTATCGGGAGGAAGATACATTACGTATTTTGCCATTATGTGGACACTACTTCCACGCCACATGCATCGACATATGGTTTCAG
CAGCACTCTACATGTCCTGTTTGTCGGATTTCCTTACGCGAGACTGCTGAGAAAAAGTGCTTCTTGCAGCCCTTGTTTAGTTCAGCTGTC
CGATCTCAATACACGATGGACACCCTGAATGTTAATTCGAACAATGCTCATCATCXTGGGCTGAAGCTTTCTTXX
Edits in Original Sequence 
GTTGGGTATTGTAAAATCTGTTTGAATGGTAGTAACAGAACAAGATTTGGAATTTTCTTGGAAATTTGATTATTGGGTTGTCGATTGGAA
GGTAAAGTTGCAATCTTGGAAAAAAATTGGGAAAAAAAG
(5')ATGACATCTTCAGCTGTAAATTTGGTGATGACAGTGATTGGGTTTAC
AGTGAGCATTATATTCATAGTATTTGXTGTGTACAAGGTTAATTTGTGCAAGAATTCAGTATTTGACAAGGAGGAGGTCTTCTGCATATA
CTTCtAGATCTGATCTTAGCATTTTGGAACGTGGTTTACATGGGCTGGAGCCTCTTGCTGTGTCGAAGTTCCCCACGAAGAAGTACAGTG
ATGCATTTTTTTCATTTGCAGAAAATACTCAATGCATGATTTGCCTTGCTGAGTATCGGGAGGAAGATACATTACGTATTTTGCCATTAT
GTGGACACTACTTCCACGCCACATGCATCGACATATGGTTTCAGCAGCACTCTACATGTCCTGTTTGTCGGATTTCCTTACGCGAGACTG
CTGAGAAAAAGTGCTTCTTGCAGCCCTTGTTTAGTTCAGCTGTCCGATCTCAATACACGATGGACACCCTGAATGTTAATTCGAACAATG
CTCATCATCXTGGGCTGAAGCTTTCTTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan