ESTScan Details for Unigene SGN-U329977

Score 
293
Direction 
Forward
Predicted Peptide Sequence 
GDAKIHLDTFLSVFNISGLPGEYYHNTGKLSNDGDRFVDGAIIAAARTLPTWSDGDLPPIPSLERKAVKELQEECHQMLAEFPTTSDEDQ
KILDSMPECRRTFEAAIKYRLXSEITDREGYTGLGHLPRQDSVLNRITAGVEAIFTRNHVAIEDGRQDYGSISAMQKALSITIAFATF
Predicted Coding Sequence 
XCCGGAGATGCCAAAATTCATCTAGACACCTTTTTATCGGTCTTTAACATATCTGGCCTCCCTGGAGAATATTACCACAACACAGGTAAG
CTATCAAATGATGGAGACAGATTCGTCGATGGAGCAATAATAGCAGCCGCAAGAACGTTGCCCACTTGGTCAGATGGAGATCTCCCTCCA
ATTCCAAGTCTAGAGAGGAAAGCAGTGAAGGAGCTGCAAGAAGAATGCCACCAGATGCTTGCAGAATTTCCCACAACTTCTGACGAAGAC
CAGAAAATCCTAGATTCGATGCCTGAATGCAGGAGAACATTCGAAGCAGCAATAAAGTATAGATTAXCATCGGAAATTACTGATAGAGAA
GGTTATACAGGCCTTGGACATTTACCAAGACAGGATTCTGTTCTAAACAGAATAACAGCAGGAGTTGAAGCAATCTTTACCAGAAATCAT
GTAGCCATAGAAGACGGGCGTCAAGATTATGGTTCCATTTCAGCTATGCAGAAAGCTTTATCTATCACAATAGCTTTTGCAACATTTTGA
Edits in Original Sequence 
(5')XCCGGAGATGCCAAAATTCATCTAGACACCTTTTTATCGGTCTTTAACATATCTGGCCTCCCTGGAGAATATTACCACAACACAGG
TAAGCTATCAAATGATGGAGACAGATTCGTCGATGGAGCAATAATAGCAGCCGCAAGAACGTTGCCCACTTGGTCAGATGGAGATCTCCC
TCCAATTCCAAGTCTAGAGAGGAAAGCAGTGAAGGAGCTGCAAGAAGAATGCCACCAGATGCTTGCAGAATTTCCCACAACTTCTGACGA
AGACCAGAAAATCCTAGATTCGATGCCTGAATGCAGGAGAACATTCGAAGCAGCAATAAAGTATAGATTAXCATCGGAAATTACTGATAG
AGAAGGTTATACAGGCCTTGGACATTTACCAAGACAGGATTCTGTTCTAAACAtGAATAACAGCAGGAGTTGAAGCAATCTTTACCAGAA
ATCATGTAGCCATAGAAGACGGGCGTCAAGATTATGGTTCCATTTCAGCTATGCAGAAAGCTTTATCTATCACAATAGCTTTTGCAACAT
TTTGA(3')GGGCTTTTGTTGGGGGTGGGTGTAGGAAGTAGCTAGTAATGGTGTATAGGTGGAAAATGACTTATACCATTAGTTTTGGAA
AGATATGAAGTGAAGAAAAATGAGAAGTTCTCTATAGAAATCATGATGAAAATGAAGGATAGCTTTGGTGGATATGTTTGATAACAAGTA
GAAGGGCTCTTTTGCATGAATGAAATATATGAATTCTCTTTAACCAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan