ESTScan Details for Unigene SGN-U329979

Score 
699
Direction 
Forward
Predicted Peptide Sequence 
KVPLMDTGTFXFNTLYHSTQVIAVLVGGISILAGHITAEQLTKFVLYSXMVDLFYMVGRGQFFVIDAIIGASEKVFQLMDLGSRDKFIDK
GAKLEGLAGRIEFVNISFYYPSRVEVPVLQHINFVVHPGEVVALVGLSGSGKSTLVNLLLRLYEPISGQISIDGYPIRDLNIKWLRERIG
YVGQEPRLFRMDISSNIRYGCSRDVNQQDVEWAAKEAAAHDFISSLPNGFHTIVDNDLLSGGQKQRIAIARAILRDPDILVLDEATSALD
AESEHNIKGVLCAVRRELKSKRTVIVIAHRVSTIQAAD
Predicted Coding Sequence 
XXCAAAGTGCCGCTTATGGATACTGGAACTTTTGXTTTCAACACACTTTATCACTCAACTCAGGTTATTGCTGTGCTGGTAGGAGGAATA
TCTATCCTGGCTGGTCATATTACTGCAGAACAACTTACCAAATTCGTATTATACAGTGAXATGGTTGATTTATTCTACATGGTGGGTAGG
GGACAATTTTTCGTCATTGATGCAATTATTGGGGCAAGTGAGAAGGTTTTTCAATTAATGGATCTCGGTTCTAGAGATAAATTCATTGAC
AAAGGAGCCAAGTTGGAAGGATTAGCAGGACGCATTGAATTTGTGAATATTAGTTTCTACTATCCTTCAAGAGTTGAGGTGCCAGTACTT
CAACATATTAACTTTGTGGTGCATCCCGGTGAAGTAGTAGCACTCGTTGGCCTAAGTGGTAGTGGAAAAAGCACTCTGGTGAACCTTCTC
CTTCGGCTGTATGAGCCAATAAGTGGGCAGATATCTATTGATGGCTACCCGATTAGAGATTTGAACATCAAGTGGTTGAGGGAAAGAATT
GGATATGTGGGACAGGAACCTAGACTTTTCCGCATGGATATCAGCTCAAACATAAGATATGGCTGTAGTAGAGATGTCAATCAACAAGAT
GTGGAATGGGCTGCCAAGGAGGCCGCTGCCCATGATTTTATTTCATCTCTACCCAATGGCTTCCACACAATTGTTGATAATGATTTGCTC
AGTGGAGGCCAGAAGCAGCGAATTGCAATTGCTAGAGCCATTCTTAGGGATCCAGATATTTTAGTACTTGATGAAGCCACTAGTGCTCTA
GATGCAGAGAGTGAACACAACATTAAAGGTGTGCTTTGTGCTGTCAGAAGAGAACTGAAATCAAAGAGAACTGTCATTGTGATTGCACAC
CGGGTTTCGACAATACAAGCTGCTGAC
Edits in Original Sequence 
(5')XXCAAAGTGCCGCTTATGGATACTGGAACTTTTGXTTTCAACACACTTTATCACTCAACTCAGGTTATTGCTGTGCTGGTAGGAGG
AATATCTATCCTGGCTGGTCATATTACTGCAGAACAACTTACCAAATTCGTATTATACAGTGAXATGGTTGATTTATTCTACATGGTGGG
TAGGGGACAATTTTTCGTCATTGATGCAATcTATTGGGGCAAGTGAGAAGGTTTTTCAATTAATGGATCTCGGTTCTAGAGATAAATTCA
TTGACAAAGGAGCCAAGTTGGAAGGATTAGCAGGACGCATTGAATTTGTGAATATTAGTTTCTACTATCCTTCAAGAGTTGAGGTGCCAG
TACTTCAACATATTAACTTTGTGGTGCATCCCGGTGAAGTAGTAGCACTCGTTGGCCTAAGTGGTAGTGGAAAAAGCACTCTGGTGAACC
TTCTCCTTCGGCTGTATGAGCCAATAAGTGGGCAGATATCTATTGATGGCTACCCGATTAGAGATTTGAACATCAAGTGGTTGAGGGAAA
GAATTGGATATGTGGGACAGGAACCTAGACTTTTCCGCATGGATATCAGCTCAAACATAAGATATGGCTGTAGTAGAGATGTCAATCAAC
AAGATGTGGAATGGGCTGCCAAGGAGGCCGCTGCCCATGATTTTATTTCATCTCTACCCAATGGCTTCCACACAATTGTTGATAATGATT
TGCTCAGTGGAGGCCAGAAGCAGCGAATTGCAATTGCTAGAGCCATTCTTAGGGATCCAGATATTTTAGTACTTGATGAAGCCACTAGTG
CTCTAGATGCAGAGAGTGAACACAACATTAAAGGTGTGCTTTGTGCTGTCAGAAGAGAACTGAAATCAAAGAGAACTGTCATTGTGATTG
CACACCGGGTTTCGACAATACAAGCTGCTGAC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan