ESTScan Details for Unigene SGN-U330039

Score 
659
Direction 
Forward
Predicted Peptide Sequence 
CLADGTKIAVKCLDGIGQVKTSFLAEVETIGSIHHXKLGAIDWLLAEKSHRLLVYECMSNGSLEKWIYHGKQEQTLDWNCRRKIIQDIAK
GLAYLHEECRQKILHLDIKPPNILLDEKYNAKLADFGLSKLIDRNQSQVMTQMRGTPGYLAPEWLSGVITEKVDVYSFGIVILEILSGRR
HFEALESEDEQVMVNLFRRKAEEGQLVDLIDKHSEDMQFYKEEVVKAMQIAAWCLQSDYTKRPSMSMVVKAMEGVIDVDKDLDYSFRPQT
VSAIPNICFADSAPXTAFGPIRP
Predicted Coding Sequence 
TGCTTAGCGGATGGCACAAAGATTGCAGTGAAATGCCTTGATGGAATAGGACAAGTCAAAACGTCATTCTTAGCTGAGGTTGAAACTATT
GGCAGCATACATCATGXTAAACTTGGTGCAATTGATTGGCTTCTGGCTGAGAAATCTCACAGGCTTTTAGTATATGAGTGCATGAGCAAC
GGATCACTAGAAAAATGGATCTACCACGGGAAACAGGAGCAAACTCTAGACTGGAACTGCAGGAGGAAGATTATTCAAGACATAGCCAAA
GGATTAGCCTACCTTCACGAAGAATGCAGGCAAAAGATTCTGCATTTGGATATTAAGCCCCCAAACATACTCCTGGATGAGAAGTACAAT
GCTAAACTCGCTGACTTTGGGCTTTCAAAGCTAATTGATCGGAATCAGAGCCAAGTTATGACTCAGATGAGAGGCACTCCTGGTTATTTG
GCTCCTGAATGGCTTAGTGGAGTTATAACAGAGAAGGTAGACGTCTATAGCTTTGGCATTGTGATCTTGGAAATTTTGAGTGGAAGAAGA
CATTTTGAAGCATTGGAGTCTGAAGACGAACAGGTAATGGTGAACTTATTCAGGAGAAAAGCAGAGGAAGGGCAGTTGGTTGATCTTATT
GATAAGCACAGTGAAGATATGCAGTTTTACAAAGAAGAAGTAGTCAAGGCAATGCAGATTGCTGCCTGGTGTTTACAAAGTGATTACACG
AAGAGGCCATCAATGTCGATGGTGGTCAAGGCCATGGAGGGTGTTATAGATGTTGACAAGGATCTAGACTACAGCTTTAGACCACAAACT
GTTTCCGCAATACCAAATATCTGTTTTGCAGATTCAGCTCCTXTTACTGCCTTCGGTCCTATCAGGCCCTAG
Edits in Original Sequence 
(5')TGCTTAGCGGATGGCACAAAGATTGCAGTGAAATGCCTTGATGGAATAGGACAAGTCAAAACGTCATTCTTAGCTGAGGTTGAAAC
TATTGGCAGCATACATCATGXTAAACTTGGTGCAATTGATTGGCTTCTGcGCTGAGAAATCTCACAGGCTTTTAGTATATGAGTGCATGA
GCAACGGATCACTAGAAAAATGGATCTACCACGGGAAACAGGAGCAAACTCTAGACTGGAACTGCAGGAGGAAGATTATTCAAGACATAG
CCAAAGGATTAGCCTACCTTCACGAAGAATGCAGGCAAAAGATTCTGCATTTGGATATTAAGCCCCCAAACATACTCCTGGATGAGAAGT
ACAATGCTAAACTCGCTGACTTTGGGCTTTCAAAGCTAATTGATCGGAATCAGAGCCAAGTTATGACTCAGATGAGAGGCACTCCTGGTT
ATTTGGCTCCTGAATGGCTTAGTGGAGTTATAACAGAGAAGGTAGACGTCTATAGCTTTGGCATTGTGATCTTGGAAATTTTGAGTGGAA
GAAGACATTTTGAAGCATTGGAGTCTGAAGACGAACAGGTAATGGTGAACTTATTCAGGAGAAAAGCAGAGGAAGGGCAGTTGGTTGATC
TTATTGATAAGCACAGTGAAGATATGCAGTTTTACAAAGAAGAAGTAGTCAAGGCAATGCAGATTGCTGCCTGGTGTTTACAAAGTGATT
ACACGAAGAGGCCATCAATGTCGATGGTGGTCAAGGCCATGGAGGGTGTTATAGATGTTGACAAGGATCTAGACTACAGCTTTAGACCAC
AAACTGTTTCCGCAATACCAAATATCTGTTTTGCAGATTCAGCTCCTXTTACTGCCTTCGGTCCTATCAGGCCCTAG(3')GTGAGGAGG
AAGTTCCTTGGAATTTTTGTAAATTTCTTGTTTTTATGCTATTGCAGCTTGTTTGCTGCTGTGTCAATTTAAAAAAAAAAAAAAAAAAAA
AA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan