ESTScan Details for Unigene SGN-U330267

Score 
623
Direction 
Forward
Predicted Peptide Sequence 
SQQLALLGTAFTIAEELLPMVVSRIWNVLNESKEVGSENVMPAANNTVELKDWRRQLQHSLDKLRDNFCRQYVVNFIYSRDGDARLDAQI
YLSGVGQDTIWDADPLPSLPFQALFGKLQQLATVAGDVLLGREKIQKVLLARLTETVVMWLSDEQEFWSVLEDESAPLQPLGLQQLILDM
HFTVEIARFAGYPSRHVHQISSDIIARAVRTFSARGVDPQSALPEDEWFTETAKGAINKLLLGGSGSDTSEIDDEHIIMHDEGMSDSDGS
PSSLSSADSSESFASAEMGDLHSPVYLSDPES
Predicted Coding Sequence 
TCTCAGCAGCTTGCACTATTGGGAACTGCATTTACCATTGCTGAGGAACTATTGCCTATGGTTGTATCTAGAATTTGGAATGTTCTTAAT
GAAAGCAAGGAAGTGGGGTCTGAAAATGTGATGCCTGCCGCAAACAATACCGTAGAACTCAAGGACTGGAGGCGTCAACTTCAGCATTCA
CTGGACAAACTTAGAGATAATTTCTGTCGACAATATGTTGTTAATTTCATATATTCAAGAGATGGTGATGCACGATTAGATGCTCAGATT
TATTTGAGTGGTGTCGGACAAGATACAATTTGGGACGCTGATCCGCTACCTTCATTGCCATTTCAGGCATTATTTGGTAAGCTGCAGCAA
TTAGCAACTGTGGCAGGAGATGTTCTTCTCGGAAGAGAGAAGATACAGAAGGTTTTGCTTGCCAGACTGACAGAGACTGTGGTAATGTGG
TTGTCTGATGAACAAGAATTTTGGAGTGTTCTAGAGGATGAGTCAGCTCCTCTGCAGCCGCTGGGTTTGCAGCAGTTAATTCTTGACATG
CACTTCACTGTTGAAATTGCACGATTCGCGGGCTATCCATCAAGGCACGTGCATCAAATATCATCAGACATAATTGCACGTGCAGTGAGG
ACTTTTTCTGCCAGGGGCGTAGATCCACAAAGTGCCCTACCCGAGGACGAATGGTTCACTGAGACCGCAAAAGGAGCCATAAACAAGCTT
CTCCTAGGTGGTTCTGGATCAGATACATCTGAGATTGATGATGAACACATCATTATGCATGATGAGGGGATGTCGGACTCTGATGGATCG
CCTTCTTCCCTCTCAAGTGCAGATAGTTCTGAGTCATTTGCCTCAGCAGAAATGGGTGATTTACATAGCCCTGTGTATTTATCTGATCCT
GAGAGTTAA
Edits in Original Sequence 
(5')TCTCAGCAGCTTGCACTATTGGGAACTGCATTTACCATTGCTGAGGAACTATTGCCTATGGTTGTATCTAGAATTTGGAATGTTCT
TAATGAAAGCAAGGAAGTGGGGTCTGAAAATGTGATGCCTGCCGCAAACAATACCGTAGAACTCAAGGACTGGAGGCGTCAACTTCAGCA
TTCACTGGACAAACTTAGAGATAATTTCTGTCGACAATATGTTGTTAATTTCATATATTCAAGAGATGGTGATGCACGATTAGATGCTCA
GATTTATTTGAGTGGTGTCGGACAAGATACAATTTGGGACGCTGATCCGCTACCTTCATTGCCATTTCAGGCATTATTTGGTAAGCTGCA
GCAATTAGCAACTGTGGCAGGAGATGTTCTTCTCGGAAGAGAGAAGATACAGAAGGTTTTGCTTGCCAGACTGACAGAGACTGTGGTAAT
GTGGTTGTCTGATGAACAAGAATTTTGGAGTGTTCTAGAGGATGAGTCAGCTCCTCTGCAGCCGCTGGGTTTGCAGCAGTTAATTCTTGA
CATGCACTTCACTGTTGAAATTGCACGATTCGCGGGCTATCCATCAAGGCACGTGCATCAAATATCATCAGACATAATTGCACGTGCAGT
GAGGACTTTTTCTGCCAGGGGCGTAGATCCACAAAGTGCCCTACCCGAGGACGAATGGTTCACTGAGACCGCAAAAGGAGCCATAAACAA
GCTTCTCCTAGGTGGTTCTGGATCAGATACATCTGAGATTGATGATGAACACATCATTATGCATGATGAGGGGATGTCGGACTCTGATGG
ATCGCCTTCTTCCCTCTCAAGTGCAGATAGTTCTGAGTCATTTGCCTCAGCAGAAATGGGTGATTTACATAGCCCTGTGTATTTATCTGA
TCCTGAGAGTTAA(3')AACAATACTGTCAAGTGATTTAGAAGTTGTATCTGATGCAAGTACCTGTGTTACGTTCTGTTGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan