ESTScan Details for Unigene SGN-U330353

Score 
66
Direction 
Forward
Predicted Peptide Sequence 
WRIRWLKVFFDGAKNLRGYGMKVVLISQMGKLFGINKTQIPFSNNMADMKIAFWDSDKQLTSMSRNVDNRRFRPINSSSLRRVGDQESEV
LRIYGVRAXSYKKGSSRRNSSMYQRSKTNSADVLAPLSMIQHPDHNHICPIYIHVYIYIYEQSPYCFHADKEPDGKPWYHDIQXIVKESE
YPEDATSAQKCMVRSLTNQFFLSGEVLYRRTRDLGLLWCIDAGELAGWLKRYLQHNXDPHMNGYTLKNDFEIXIIRVNHRDNPMSEISSM
PX
Predicted Coding Sequence 
XXCTGGAGAATACGGTGGTTGAAGGTATTCTTTGATGGAGCTAAAAATCTAAGAGGATATGGCATGAAAGTTGTTCTAATCTCACAAATG
GGCAAACTATTCGGTATCAACAAAACTCAGATTCCTTTCTCAAATAATATGGCTGATATGAAGATTGCATTTTGGGACTCCGACAAGCAA
TTGACCTCGATGTCAAGAAATGTTGATAATAGAAGATTCAGACCTATCAATTCATCAAGTTTGAGGCGAGTGGGTGACCAAGAATCAGAA
GTTCTTCGCATATATGGAGTGCGTGCATAXAGTTATAAAAAAGGTTCATCAAGACGGAATTCAAGCATGTATCAAAGATCCAAAACAAAT
TCCGCAGATGTGTTAGCCCCTTTATCTATGATTCAGCATCCTGATCATAATCATATTTGTCCCATTTACATTCATGTATATATATATATA
TATGAGCAATCACCATATTGCTTTCATGCTGATAAGGAGCCTGATGGAAAGCCTTGGTACCATGATATTCAAGAXATAGTTAAAGAAAGT
GAATATCCAGAAGATGCAACTAGTGCACAAAAATGCATGGTTCGAAGCTTAACAAATCAATTTTTTCTAAGTGGAGAAGTCCTTTATAGA
AGGACTCGAGATTTGGGTTTGCTGTGGTGCATTGATGCTGGAGAACTAGCAGGTTGGTTGAAAAGATACTTGCAACATAATGXTGATCCT
CACATGAACGGTTATACTCTAAAAAATGATTTTGAGATTANGATAATCCGTGTTAACCATCGAGACAACCCTATGTCAGAAATTTCATCA
ATGCCTGAX
Edits in Original Sequence 
(5')XXCTGGAGAATACGGTGGTTGAAGGTATTCTTTGATGGAGCTAAAAATCTAAGAGGATATGGCATGAAAGTTGTTCTAATCTCACA
AATGGGCAAACTATTCGGTATCAACAAAACTCAGATTCCTTTgCTCAAATAATATGGCTGATATGAAGATTGCATTTTGGGACTCCGACA
AGCAATTGACCTCGATGTCtAAGAAATGTTGATAATAGAAGATTCAGACCTATCAATTCATCAAGTTTGAGGCGAGTGGGTGACCAAGAA
TCAGAAGTTCTTCGCATATATGGAGTGCGTGCATAXAGTTATAAAAAAGGTTCATCAAGACGGAATTCAAGCATGTATCAAAGATCCAAA
ACAAATTCCGCAGATGTGTTAGCCCCTTTATCTATGATTCAGCATCCTGATCATAATCATATTTGTCCCATTTACATTCATGTATATATA
TATATATATGAGCAATCACCATATTGCTTTCATGCTGATAAGGAGCCTGATGGAAAGCCTTGGTACCATGATATTCAAGAXATAGTTAAA
GAAcAGTGAATATCCAGAAGATGCAACTAGTGCACAAAAATGCATGGTTCGAAGCTTaAACAAATCAATTTTTTCTAAGTGGAGAAGTCC
TTTATAGAAGGACTCGAGATTTGGGTTTGCTGTGGTGCATTGATGCTGGAGAACTAGCAGGTTGGTTGAAAAGATACTTGCAACATAATG
XTGATCCTCACATGAACGGTTATACTCTAAAAAATGATTTTGAGATTANGATAATCCGTGTTAACCATCGAGACAACCCTATGTCAGAAA
TTTCATCAATGCCTGAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan