ESTScan Details for Unigene SGN-U330355

Score 
-29
Direction 
Forward
Predicted Peptide Sequence 
PFNHLARNEAGLPREWYDPSSSVEDKQKKLSQVYDRLECIIAMEKDNSSLNVHMDDSYIEELIXTWKKKLLTAANAPAKVKQAGPPIVKG
LXYLFDLTGPQPEHDFAVITQPSHVDYQTEPRLLIYNLEAXDVLQTRLALDLIDDAFSRDRTWHNVELFSSGGATYKVQ
Predicted Coding Sequence 
XGACCATTCAACCATTTGGCTAGAAATGAAGCTGGTCTTCCACGGGAATGGTATGACCCTTCTTCAAGTGTAGAAGATAAGCAAAAGAAG
TTATCTCAGGTTTATGATCGACTGGAATGCATAATTGCTATGGAAAAGGACAACTCGAGTCTAAATGTCCACATGGATGATTCCTATATC
GAGGAACTGATTGXTACTTGGAAGAAAAAATTACTGACAGCGGCAAATGCGCCTGCTAAAGTTAAACAAGCTGGTCCGCCAATTGTAAAA
GGACTTGXTTACCTCTTTGATCTCACAGGGCCACAACCTGAGCACGATTTTGCTGTCATCACTCAACCTAGTCACGTCGACTATCAAACA
GAGCCTAGACTATTGATATACAATCTTGAAGCTXCTGATGTTTTGCAGACTAGATTGGCATTGGATTTGATTGATGATGCCTTTTCTCGT
GACAGAACCTGGCATAACGTCGAGCTCTTCAGCAGTGGCGGAGCCACATATAAGGTCCAGTAG
Edits in Original Sequence 
(5')XGACCATTCAACCATTTGGCTAGAAATGAAGCTGGTCTTCCACGGGAATGGTATGACCCTTCTTCAAGTGTAGAAGATAAGCAAAA
GAAGTTATCTCAGGTTTATGATCGACTGGAATGCATAATTGCTATGGAAAAGGACAACTCGAGTCTAAATaGTCCACATGGATGATTCCT
ATATCGAGGAACTGATTGXTACTTGGAAGAAAAAATTACTGACAGCGGCAAATGCGCCTGCTAAAGtTTAAACAAGCTGGTCCGCCAATT
GTAAAAGGACTTGXTTACCTCTTTGATCTCACAGGGCCACAACCTGAGCACGATTTTGCTGTCATCACTCtAACCTAGTCACGTCGACTA
TCAAACAGAGCCTAGACTATTGATAtTACAATCTTGAAGCTXCTGATGTTTTGCAGACTAGATTGGCATTGGATTTGATTGATGATaGCC
TTTTCTCGTGACAGAACCTGGCATAACGTCGAGCTCTTCAGCAGTGGCGGAGCCACATATAAGGTCCAGTAG(3')AATCCCCTTCATCG
AAAATTATACTGTACAAATAAGGTAAAACCAAATTTTCTTGTATGCATATAAATATCTGAATCCTCTTGATATATATAAATCTTAGTGTG
CTAGTGTGTATACATTCTGGCATTTTCTAGAATATCTTTAGCCGGCAGCCGTGCACTTGAGCCCAAGGATCTGTCGAAAACCACCTCTCT
ACTTTCCCGAGGTAGGGGTAAGAGTACGTACATGTATCTCTCTCCGGATTTCATTTGTGGGAAATATTGGATATGTTGTTGTAGTTTTAC
TCGTAGTCGAGAGCTGATAGGGAGTTCAACCTATGAGTTCATCCTAACTCACTAGCTCTGGCTTGAACCCTATTCACTTTTTAAGTGCAA
ATGAGTTATGGTAAAATGTTTGAAACTCAATTCATGAAGTTTGAAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan