ESTScan Details for Unigene SGN-U330419

Score 
338
Direction 
Forward
Predicted Peptide Sequence 
HSPTKSVLNQTPYEAWTGQKPRVSHLNVFGCIAYALVNLRXKLDEKLQKCICIAYSSQSKAYRLYNPTSCIVIININIVFNEESAWEWND
KEEDSVIQIPAHAKVGHTRILEIASSDFSSPGSSNTDHTAHGSGNNSTPPSSCSPRLASSSEMPPTKFQSLQDVYASCSFALLAAKPTCY
EEDAKQLEWQDAMIEEIQAIEKNQTWDLVDLPERKNVIGLKWIFKTKYNADGSVKRHKARL
Predicted Coding Sequence 
CATTCTCCAACCAAATCCGTATTAAATCAAACTCCATATGAAGCATGGACAGGACAGAAACCACGAGTAAGCCACTTGAATGTTTTTGGT
TGTATAGCTTATGCTTTGGTTAATTTACGTXTTAAGCTAGATGAAAAATTACAGAAATGTATTTGCATTGCGTATAGTTCTCAATCCAAA
GCATATAGACTATATAATCCTACTAGTTGCATAGTGATTATCAACATAAATATTGTATTTAATGAAGAATCAGCCTGGGAGTGGAACGAT
AAGGAAGAAGATTCAGTCATCCAAATTCCAGCTCACGCAAAAGTAGGGCATACAAGGATACTTGAAATAGCAAGTTCTGATTTTTCCTCA
CCTGGTAGCAGCAATACTGACCATACTGCTCATGGAAGTGGCAACAATTCTACTCCACCAAGCTCTTGTTCACCACGTTTGGCATCATCC
AGCGAGATGCCACCAACAAAGTTCCAGTCACTGCAAGATGTTTATGCATCTTGTAGTTTTGCCCTATTAGCTGCCAAACCGACATGTTAT
GAAGAAGATGCAAAGCAACTAGAGTGGCAGGATGCGATGATTGAAGAGATTCAGGCTATCGAGAAAAATCAGACCTGGGATCTAGTTGAT
TTGCCGGAAAGAAAGAATGTTATCGGGCTAAAATGGATTTTCAAAACAAAGTACAATGCTGATGGAAGTGTCAAAAGGCATAAAGCTCGA
CTX
Edits in Original Sequence 
(5')CATTCTCCAACCAAATCCGTATTAAATCAAACTCCATATGAAGCATGGACAGGACAGAAACCACGAGTAAGCCACTTGAATGTTTT
TGGTTGTATAGCTTATGCTTTGGTTAATTTACGTXTTAAGCTAGATGAAAAATTACAGAAATGTATTTGCATTGCGTATAGTTCTCAATC
CAAAGCATATAGACTATATAATCCTACTAGTTGCATAGTGATTATCAACATAAATATTGTATTTAATGAAGAATCAGCCTGGGAGTGGAA
CGATAAGGAAGAAGATTCAGTCATCCAAATTCCAGCTCACGCAAAAGTAGGGCATACAAGGATACTTGAAATAGCAAGTTCTGATTTTTC
CTCACCTGGTAGCAGCAATACTGACCATACTGCTCATGGAAGTGGCAACAATTCTACTCCACCAAGCTCTTGTTCACCACGTTTGGCATC
ATCCAGCGAGATGCCACCAACAAAGTTCCAGTCACTGCAAGATGTTTATGCATCTTGTAGTTTTGCCCTATTAGCTGCCAAACCGACATG
TTATGAAGAAGATGCAAAGCAACTAGAGTGGCAGGATGCGATGATTGAAGAGATTCAGGCTATCGAGAAAAATCAGACCTGGGATCTAGT
TGATTTGCCGGAAAGAAAGAATGTTATCGGGCTAAAATGGATTTTCAAAACAAAGTACAATGCTGATGGAAGTGTCAAAAGGCATAAAGC
TCGACTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan