ESTScan Details for Unigene SGN-U330580

Score 
371
Direction 
Forward
Predicted Peptide Sequence 
SMNLFNFNANANPTISSAFIFLRLTAXLCNRRTTRFSVRFSSESTHRVKLAESLQSETLKLLEWPAVCQQLSAFTSTSMGYAAAQSARIP
VGKTREESSRLLSQTSAAVAVPRPLDFTGIEDISPIVDASVAGGVLSIREXLLCETNLGSGEIFAPTVGGDXIFLKVNSKWRSMSHVVVM
DSHEVPFXIVLSSFIRMSNYXSNRYSSLKEILHSCDFLVELEQKIEFCIDCSFSVILDRASEDLEIIRSERKRNMDNLELLFKQLSTQVF
QGGGFDRPLVTKRRSRLCVAVRASHRSLLPNSVILDTSSSGSTYFMEPKEAVELNNMEVKLSSSEKVEEQTILSLLTSEIAESNMKIKHL
Predicted Coding Sequence 
XCTTCAATGAATCTTTTCAACTTCAATGCAAATGCAAATCCAACAATTTCTTCAGCATTCATCTTCCTCCGCCTCACAGCTCXGCTCTGT
AACCGTCGTACAACTAGGTTCTCCGTCCGTTTCTCATCCGAGTCAACTCACAGAGTCAAACTCGCCGAGTCACTGCAATCCGAAACCTTG
AAGCTTCTAGAATGGCCCGCCGTGTGTCAACAGCTCTCCGCTTTCACGTCCACATCCATGGGATACGCCGCAGCACAATCTGCTCGGATT
CCGGTGGGTAAAACTCGTGAAGAGAGCAGTAGACTTCTCTCTCAGACCTCGGCCGCGGTGGCTGTACCTCGGCCGTTGGATTTTACCGGA
ATTGAAGATATTTCCCCAATTGTTGATGCTTCCGTTGCAGGCGGTGTACTCTCGATTCGTGAAXCTTTGCTCTGTGAAACGAACCTTGGC
AGCGGCGAGATTTTTGCTCCAACAGTTGGAGGAGATXTGATTTTTCTGAAAGTTAACTCAAAATGGCGAAGCATGTCTCATGTGGTAGTG
ATGGATTCTCATGAAGTTCCATTTAAXATAGTATTGAGCAGTTTCATTAGAATGTCTAATTATXCTTCAAACAGGTACTCTTCTCTGAAG
GAAATTCTTCACAGTTGTGATTTTCTTGTGGAATTGGAGCAAAAAATAGAATTCTGTATTGATTGCAGCTTTTCAGTAATCCTTGATAGA
GCTAGTGAAGATTTGGAAATTATAAGATCCGAGAGAAAGAGGAACATGGATAATCTAGAATTATTGTTTAAGCAATTATCAACTCAAGTT
TTTCAAGGTGGAGGATTTGACAGGCCTTTAGTGACCAAGCGCCGTTCAAGATTGTGTGTTGCTGTGAGAGCTTCACATAGATCTTTGCTT
CCTAATTCCGTAATCCTAGATACAAGCAGTAGTGGATCTACATACTTCATGGAACCTAAAGAGGCAGTTGAGCTAAACAACATGGAAGTT
AAACTTTCTAGTTCTGAGAAGGTTGAGGAGCAAACAATTTTGAGTTTGCTTACATCTGAAATAGCAGAATCTAATATGAAAATAAAGCAC
TTA
Edits in Original Sequence 
(5')XCTTCAATGAATCTTTTCAACTTCAAcTGCAAATGCAAATCCAACAATTTCTTCAGCATTCATCTTCCTCCGCCTCACAGCTCXGC
TCTGTAACCGTCGTACAACTAGGTTCTCCGTCCGTTTCTCATCCGAGTCAACTCACAGAGTCAAACTCGCCGAGTCACTGCAATCCGAAA
CCTTGAAGCTTCTAGAATGGCCCGCCGTGTGTCAACAGCTCTCCGCTTTCACGTCCACATCCATGGGATACGCCGCAGCACAATCTGCTC
GGATTCCGGTGGGTAAAACTCGTGAAGAGAGCAGTAGACTTCTCTCTCAGACCTCGGCCGCGGTGGCTGTACCTCGGCCGTTGGATTTTA
CCGGAATTGAAGATATTTCCCCAATTGTTGATGCTTCCGTTGCAGGCGGTGTACTCTCGATTCGTGAAXCTTTGCTCTGTGAAACGAACC
TTGGCAGCGGCGAGATTTTTGCTCCAACAGTTGGAGGAGATXTGATTTTTCTGAAAGTTAACTCAAAATGGCGAAGCATGTCTCATGTGG
TAGTGATGGATTCTCATGAAGTTCCATTTAAXATAGTATTGAGCAGTTTCATTAGAATGTCTAATTATXCTTCAAACAGGTACTCTTCTC
TGAAGGAAATTCTTCACAGTTGTGATTTTCTTGTGGAATTGGAGCAAAAAATAGAATTCTGTATTGATTGCAGCTTTTCAGTAATCCTTG
ATAGAGCTAGTGAAGATTTGGAAATTATAAGATCCGAGAGAAAGAGGAACATGGATAATCTAGAATTATTGTTTAAGCAATTATCAACTC
AAGTTTTTCAAGGTGGAGGATTTGACAGGCCTTTAGTGACCAAGCGCCGTTCAAGATTGTGTGTTGCTGTGAGAGCTTCACATAGATCTT
TGCTTCCTAATTCCGTAATCCTAGATACAAGCAGTAGTGGATCTACATACTTCATGGAACCTAAAGAGGCAGTTGAGCTAAACAACATGG
AAGTTAAACTTTCTAGTTCTGAGAAGGTTGAGGAGCAAACAATTTTGAGTTTGCTTACATCTGAAATAGCAGAATCTAATATGAAAATAA
AGCACTTA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan