ESTScan Details for Unigene SGN-U330842

Score 
162
Direction 
Forward
Predicted Peptide Sequence 
ERAIFMKERASGMYTISSYFMARIVGDXTYGPYLAYIVSYHNILDGRAKATTLGIPFDTTSPVELCDSVTRPRPSPWAIIMDAKQASTVI
TVTMLAFVLTGGFYVHKVPACLAWIKYISTTFYSYRLLIDVQFGEGKEISDLLGCSRIQGSDRANCKFIEQDIX
Predicted Coding Sequence 
XXAGAACGTGCTATTTTCATGAAGGAAAGAGCTTCGGGTATGTACACAATCTCCTCTTATTTCATGGCGCGAATTGTTGGAGATXCTACC
TATGGACCTTATCTTGCCTACATTGTTTCTTACCATAACATATTGGATGGCCGGGCTAAAGCCACAACTCTTGGCATTCCTTTTGACACT
ACTAGTCCTGTTGAGCTATGTGATAGTGTCACAAGGCCTCGGCCTAGCCCTTGGGCTATAATCATGGATGCTAAACAAGCTTCAACCGTG
ATCACTGTCACGATGCTAGCATTCGTTCTAACAGGAGGGTTCTATGTACACAAAGTCCCAGCTTGTCTAGCCTGGATCAAGTACATATCA
ACTACATTTTACAGTTATCGGCTACTTATCGATGTTCAATTTGGCGAAGGCAAGGAGATATCAGACTTGCTAGGCTGCTCACGTATTCAA
GGAAGTGACAGAGCTAATTGCAAATTCATTGAACAAGATATCATX
Edits in Original Sequence 
(5')XXAGAACGTGCTATTTTCATGAAGGAAAGAGCTTCGGGTATGTACACAATCTCCTCTTATTTCATGGCGCGAATTGTTGGAGATXC
TACCTATGGACCTTATCTTGCCTACATTGTTTCTTACCATAACATATTGGATGGCCGGGCTAAAGCCACAACTCTTGGCATTCCTTTTGA
CACTACTAGTCCTGTTGAGCTATGTGATAGTGTCACAAGGCCTCGGCCTAGCCCTTGGcGCTATAATCATGGATGCTAAACAAGCTTCAA
CCGTGATCACTGTCACGATGCTAGCATTCGTTCTAACAGGAGGGTTCTATGTACACAAAGTCCCAGCTTGTCTAGCCTGGATCAAGTACA
TATCAACTACATTTTACAGTTATCGGCTACTTATCGATGTTCAATTTGGCGAAGGCAAGGAGATATCAGACTTGCTAGGCTGCTCACGTA
TTCAAGGAAGTGACAGAGCTAATTGCAAATTCATTGAACAAGATATCATX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan