ESTScan Details for Unigene SGN-U330857

Score 
235
Direction 
Reverse
Predicted Peptide Sequence 
NGFEYKPLTIHTMYLRSLSXPLDXLTVXDPEVLIHSFIFRSLNDRRDSMVMRAXHTVYSQPCFSAYVFVASTISNDNPASLMDDKGSPVD
VHPINGFSHIIFLGLEILKEPDGLIITRQKYTLELLSEYDCSHLPLVSSPFDPXLIVNQIFAKRCNISXQYIQDPWTSHFSAALRVLQYL
SNNPSQDLFLTSDLSVKWGVDQTVDFLSXLGGSPVSRNQKEQVSISLSSAGAEYRSMRRVVADMTWLNCLLADMGSPPELPSLVYSDSHF
VHKTIPRTPDFSAYAPAS
Predicted Coding Sequence 
XXAAATGGTTTTGAATATAAACCACTCACCATCCATACCATGTATCTTAGAAGCTTGAGTGAXCCATTAGATAAXCTCACTGTGNATGAT
CCAGAAGTGCTCATCCATTCATTCATTTTTAGAAGCTTGAATGATAGAAGGGATTCTATGGTGATGCGTGCAGXTCACACAGTGTACTCC
CAACCATGTTTCTCAGCATATGTCTTTGTTGCATCTACAATATCAAACGATAACCCTGCCTCACTAATGGATGATAAAGGGTCTCCTGTG
GATGTCCATCCAATCAATGGATTTTCCCACATTATTTTTTTGGGACTTGAGATTTTAAAGGAGCCTGATGGTCTCATTATTACTCGACAG
AAGTACACTTTGGAGCTTCTTTCTGAATATGATTGCTCCCATCTGCCACTTGTTTCTTCACCTTTTGATCCAXCACTCATAGTCAACCAA
ATATTTGCTAAGCGGTGCAACATCTCTXCTCAGTATATACAGGATCCCTGGACATCTCATTTTTCAGCTGCACTGCGAGTTCTTCAATAC
CTCAGTAACAATCCCAGTCAAGATCTGTTTCTGACAAGTGATCTTTCTGTCAAATGGGGCGTCGATCAGACAGTTGATTTTTTATCAXCA
CTTGGAGGCTCACCTGTTTCTAGGAACCAAAAAGAACAGGTCTCCATTTCCTTATCCTCTGCGGGAGCTGAGTATCGCTCCATGAGAAGA
GTCGTGGCTGATATGACATGGCTCAATTGTCTTCTTGCTGATATGGGATCTCCGCCAGAGCTCCCTAGTCTGGTTTACTCCGATAGCCAC
TTCGTACACAAAACAATTCCTCGCACACCTGATTTCTCTGCTTATGCTCCGGCTTCT
Edits in Original Sequence 
(5')XXAAATGGTTTTGAATATAAACCACTCACCATCCATACCATGTATCTTAGAAGCTTGAGTGAXCCATTAGATAAXCTCACTGTGNA
TGATCCAGAAGTGCTCATCCATTCATTCATTTTTAGAAGCTTGAATGATAGAAGGGATTCTATGGTGATGCGTGCAGXTCACACAGTGTA
CTCCCAACCATGTTTCTCAGCATATGTCTTTGTTGCATCTACAATATCAAACGATAACCCTGCCTCACTAATGGATGATAAAGGGTCTCC
TGTGGATGTCCATCCAATCAATGGATTTTCCCACATTATTTTTTTGGGACTTGAGATTTTAAAGGAGCCTGATGGTCTCATTATTACTCG
ACAGAAGTACACTTTGGAGCTTCTTTCTGAATATGATTGCTCCCATCTGCCACTTGTTTCTTCACCTTTTGATCCAXCACTCATAGTCAA
CCAAATATTTGCTAAGCGGTGCAACATCTCTXCTCAGTATATACAGGATCCCTGGACATCTCATTTTTCAGCTGCACTGCGAGTTCTTCA
ATACCTCAGTAACAATCCCAGTCAAGATCTGTTTCTGACAAGTGATCTTTCTGTCAAAtTGGGGCGTCGATCAGACAGTTGATTTTTTAT
CAXCACTTGGAGGCTCACCTGTTTCTAGGAACCAAAAAGAACAGGTCTCCATTTCCTTATCCTCTGCGGGAGCTGAGTATCGCTCCATGA
GAAGAGTCGTGGCTGATATGACATGGCTCAATTGTCTTCTTGCTGATATgGGGATCTCCGCCAGAGCTCCCTAGTCTGGTTTACTCCGAT
AGCCACTTCGTACACAAAACAATTCCTCGCACACCTGATTTCTCTGtCTTATGCTCCGGCTTCT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan