ESTScan Details for Unigene SGN-U330885

Score 
538
Direction 
Forward
Predicted Peptide Sequence 
LKERGGKAREVGAALIGGLIVSVASFGLEDEVXQDFASGDIPKSGGVSSTPSMRGTVCYIAPEYGGGGQLSEKCDVYSFGVLLLVLVSGR
RPLQVTASPMSEFERANLVSWARQLAHSGKLLDLVDSNIQLLDREQALLCITIALLCLQRSPNKRPTMKEIVGMLCGNSEPPHLPFEFSP
SPPSNFPFKSRKKAR
Predicted Coding Sequence 
XXCCTGAAAGAAAGAGGAGGAAAAGCAAGGGAAGTAGGAGCAGCATTGATTGGTGGCTTGATAGTTTCAGTGGCGAGTTTCGGATTGGAA
GACGAAGTAGXTCAAGATTTTGCCAGTGGAGATATTCCCAAGAGTGGAGGTGTGAGTAGTACCCCCAGTATGAGAGGAACAGTTTGTTAC
ATCGCTCCAGAGTATGGCGGTGGAGGGCAGCTCTCAGAGAAATGCGACGTGTACAGTTTTGGTGTTTTGTTATTGGTTTTAGTCTCAGGG
AGAAGGCCACTCCAAGTTACAGCTTCTCCTATGTCAGAATTCGAGAGGGCTAATCTGGTTTCATGGGCTAGGCAACTTGCTCATTCGGGC
AAGCTTTTGGATCTTGTTGATTCCAACATTCAGTTACTGGATAGAGAACAAGCATTGCTTTGCATCACTATTGCACTACTCTGTTTACAG
AGATCACCTAACAAGCGCCCAACAATGAAAGAGATTGTTGGGATGCTTTGTGGTAACTCTGAGCCACCCCACTTGCCGTTTGAGTTTTCC
CCTTCACCACCCTCCAATTTCCCTTTCAAGTCACGGAAGAAGGCCCGGTGA
Edits in Original Sequence 
(5')XXCCTGAAAGAAAGAGGAGGAAAAGCAAGGGAAGTAGGAGCAGCATTGATTGGTGGCTTGATAGTTTCAGTGGCGAGTTTCGGATT
GGAAGACGAAGTAGXTCAAGATTTTGCCAGTGGAGATATTCCCAAGAGTGGAGGTGTGAGTAGTACCCCCAGTATGAGAGGAACAGTTTG
TTACATCGCTCCAGAGTATGGCGGTGGAGGGCAGCTCTCAGAGAAATGCGACGTGTACAGTTTTGGTGTTTTGTTATTGGTTTTAGTCTC
AGGGAGAAGGCCACTCCAAGTTACAGCTTCTCCTATGTCAGAATTCGAGAGGGCTAATCTGGTTTCATGGGCTAGGCAACTTGCTCATTC
GGGCAAGCTTTTGGATCTTGTTGATTCCAACATTCAGTTACTGGATAGAGAACAAGCATTGCTTTGCATCACTATTGCACTACTCTGTTT
ACAGAGATCACCTAACAAGCGCCCAACAATGAAAGAGATTGTTGGGATGCTTTGTGGTAACTCTGAGCCACCCCACTTGCCGTTTGAGTT
TTCCCCTTCACCACCCTCCAATTTCCCTTTCAAGTCACGGAAGAAGGCCCGGTGA(3')GTTCAAGAGTGCTCAATTTACCATTTCACTG
TTCAATGTAAACTTCATATATTGTTGTGTAGAAATTGTTAGAAGAAAAAAAGCAAAATGTCATAATTTTCTTAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan