Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U331058

Score 
563
Direction 
Forward
Predicted Peptide Sequence 
QNEGEMTRETLSFVHAQVGFLLLFDLRFEEAIDHFLLSETMEPSELFPFIMRDPNRWSLLVPRNRYWGLHPPPSLLEKVVDDGLTGIQRA
IFLKKAGVETAVDDEFLQNPPSRADLLESAIKNMTRFLEASRHKDLAPSVCGGVDTLLMYLYRALNRVDDMERLASSDNXLRSGGVGIIA
GESGHLRVLAFLYASKGMSSKSLSIWRVLARNYSSSYLNDSHGANHLQDTINSISSDQETAVMEASQILESSSDQELVLQHLGWIADINQ
LX
Predicted Coding Sequence 
XXTCAAAATGAAGGTGAAATGACAAGGGAGACACTCTCTTTTGTTCATGCTCAAGTGGGATTCCTCTTACTATTTGACCTACGCTTTGAG
GAGGCAATTGATCATTTCTTGCTTTCAGAAACAATGGAGCCTTCAGAACTTTTTCCATTTATCATGCGAGACCCAAATCGTTGGTCCTTG
TTGGTTCCAAGGAATAGGTATTGGGGCTTGCATCCTCCTCCATCACTTCTTGAGAAAGTTGTGGACGATGGCTTAACTGGTATTCAGAGA
GCTATTTTCCTTAAGAAAGCAGGCGTTGAGACTGCAGTTGATGATGAGTTTCTTCAAAATCCACCAAGCAGAGCTGATTTATTGGAGTCT
GCAATTAAAAACATGACCAGGTTTTTAGAAGCATCACGACATAAAGATTTAGCTCCTTCCGTATGCGGAGGAGTTGACACTCTTTTGATG
TACCTTTACAGAGCTCTAAATCGTGTTGATGACATGGAAAGACTTGCCTCATCAGACAACAXGTTGCGTAGTGGAGGAGTTGGAATTATT
GCTGGTGAATCTGGGCATTTGCGGGTACTTGCCTTTCTGTACGCCAGTAAAGGGATGAGCTCAAAGTCTCTTTCAATCTGGCGTGTGCTG
GCTCGAAATTATTCATCCAGCTACTTGAATGATTCACATGGTGCAAACCACTTACAAGATACCATAAATAGTATTTCCTCTGATCAAGAG
ACTGCTGTAATGGAGGCTTCCCAAATTCTTGAGTCATCATCTGATCAGGAGTTAGTACTGCAACATCTAGGATGGATTGCAGACATCAAC
CAGCTGTTX
Edits in Original Sequence 
(5')XXTCAAAATGAAGGTGAAATGACAAGGGAGACACTCTCTTTTGTTCATGCTCAAGTGGGATTCCTCTTACTATTTGACCTACGCTT
TGAGGAGGCAATTGATCATTTCTTGCTTTCAGAAACAATGGAGCCTTCAGAACTTTTTCCATTTATCATGCGAGACCCAAATCGTTGGTC
CTTGTTGGTTCCAAGGAATAGGTATTGGGGCTTGCATCCTCCTCCATCACTTCTTGAGAAAGTTGTGGACGATGGCTTAACTGGTATTCA
GAGAGCTATTTTCCTTAAGAAAGCAGGCGTTGAGACTGCAGTTGATGATGAGTTTCTTCAAAATCCACCAAGCAGAGCTGATTTATTGGA
GTCTGCAATTAAAAACATGACCAGGTTTTTAGAAGCATCACGACATAAAGATTTAGCTCCTTCCGTATGCGGAGGAGTTGACACTCTTTT
GATGTACCTTTACAGAGCTCTAAATCGTGTTGATGACATGGAAAGACTTGCCTCATCAGACAACAXGTTGCGTAGTGGAGGAGTTGGAAT
TATTGCTGaGTGAATCTGGGCATTTGCGGGTACTTGCCTTTCTGTACGCCAGTAAAGGGATGAGCTCAAAGTCTCTTTCAATCTGGCGTG
TGCTGGCTCGAAATTATTCATCCAGCTACTTGAATGATTCACATGGTGCAAACCACTTACAAGATACCATAAATAGTATTTCCTCTGATC
AAGAGACTGCTGTAATGGAGGCTTCCCAAATTCTTGAGTCATCATCTGATCAGGAGTTAGTACTGCAACATCTAGGATGGATTGCAGACA
TCAACCAGCTGTTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan