ESTScan Details for Unigene SGN-U331101

Score 
-82
Direction 
Forward
Predicted Peptide Sequence 
ILVPTTPGSLYYYTYRSLKPLWGLCWLNTMKTDGSKGPYTTNVKKMTDYKTRYTNFEKTCLAGKAEIEALHAVLPSTFNSFHGPTKKVFV
RETRLNVTGRTARWLLLLSEFDITVCNQKGRAIAEHLAPFKEEHEFKDCFPDEEIAVTEEELKAIDCKERRAWKFDFDGTTNQNGYGVGA
LLIAPDESTPPLPLSGTFKELKNTTEDEACIHGLKTALTLGIKKSKYLGIRRLSSA
Predicted Coding Sequence 
XXCATTCTAGTGCCTACAACGCCAGGAAGCCTTTATTACTATACCTATCGGTCACTGAAACCACTATGGGGTCTATGTTGGCTTAATACG
ATGAAGACAGACGGAAGTAAAGGGCCATATACTACCAACGTXAAGAAAATGACTGACTACAAGACCAGGTATACCAATTTTGAGAAAACC
TGCTTGGCGGGTAAGGCGGAAATTGAGGCATTACATGCTGTCTTACCCAGTACATTTAATAGCTTCCATGGACCTACAAAAAAAGTATTT
GTTCGAGAAACCCGCCTTAACGTAACGGGAAGGACCGCAAGATGGTTACTGCTTCTGTCTGAATTCGACATCACXGTATGTAACCAAAAA
GGAAGGGCGATAGCAGAACACCTTGCACCCTTCAAGGAGGAACATGAGTTTAAGGATTGCTTCCCAGACGAGGAAATAGCTGTCACAGAA
GAGGAGCTGAAAGCCATTGACTGTAAGGAGAGGAGGGCATGGAAATTTGACTTTGATGGCACGACTAATCAAAATGGGTACGGAGTAGGG
GCATTGCTGATTGCACCTGATGAATCCACACCCCCATTGCCATTAAGCGGAACTTTTAAGGAACTXAAGAATACCACTGAAGATGAAGCA
TGTATCCATGGATTAAAGACTGCCTTGACCCTGGGAATAAAGAAATCGAAGTATTTAGGGATTCGACGCTTATCATCTGCX
Edits in Original Sequence 
(5')XXCATTCTAGTGCCTACAACGCCAGGAAGCCTTTATTACTATACCTATCGGTCACTGAAACCACTATGGGGTCTATGTTGGCTTAA
TACGATGAAGACAGACGGAAGTAAAGGGCCATATACTACCAACGTXAAGAAAATGACTGACTACAAGACCAGGTATACCAATTTTGAGAA
AACCTGCTTGGCGGGTAAGGCGGAAATTGAGGCATTACATGCTGTCTTACCCAGTACATTTAATAGCTTCCATGGACCTACAAAAAAAGT
ATTTGTTCGAGAAACCCGCCTTAACGTAACGGGAAGGACCGCAAGATGGTTACTGCTTCTGTCTGAATTCGACATCACXGTATGTAACCA
AAAAGGAAGGGCGATAGCAGAACACCTTGCACCCTaTCAAGGAGGAACATGAGTTTAAGGATTGCTTCCCAGACGAGGAAATAGCTGTCA
CAGAAGAGGAGCTGAAAGCCAcTTGACTGTAAGGAGAGGAGGGCATGGAAATTTGACTTTGATGGCACGACTAATCAAAATGGGTACGGA
GTAGGGGCATTGCTGATTGCACCTGATGAATCgCACACCCCCATTGCCATTAAGCGGAACTTTTAAGGAACTXAAGAATACCACTGAAGA
TGAAGCATGTATCCATGGATTAAAGACTGCCTTGACCCTGGGAATAtAAGAAATCGAAGTATTTAGGGATTCGACGCTTATCATCTGCX
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan