ESTScan Details for Unigene SGN-U331208

Score 
315
Direction 
Reverse
Predicted Peptide Sequence 
MKGLMRFPKKVNLSPTYVGPYKIFKRVGQVAYELDLPAELATVHLVFHISLWKKCVGDSSSSVPLESVAVKDSLYDEDVEIIDRHLXKAL
KKEVASVKVLGRSNTVKGDSWESKAAMKAKNPYLFPSDSTQA
Predicted Coding Sequence 
ATGAAAGGGTTGATGAGATTTCCAAAGAAAGTAAATCTTAGTCCTACATATGTAGGCCCTTACAAGATATTTAAAAGGGTTGGACAGGTG
GCATATGAGTTAGACTTGCCAGCAGAATTAGCAACAGTGCATCTGGTCTTCCACATCTCACTCTGGAAGAAGTGTGTGGGCGATTCATCC
TCTTCAGTGCCATTAGAGAGTGTGGCGGTAAAAGATAGTCTTTATGATGAGGATGTAGAGATTATCGATCGTCACCTTAXGAAGGCTTTG
AAAAAAGAAGTTGCATCAGTCAAGGTTTTAGGGAGGAGTAATACTGTAAAGGGAGATTCTTGGGAATCAAAAGCAGCCATGAAAGCCAAG
AATCCTTACCTCTTTCCTTCTGATTCCACTCAAGCTTGA
Edits in Original Sequence 
TTCCAGCATTCAGATGTCCCCTTATGAGGCTTTATATGGAAGTAGATGTAAATGTCCTGTTGTTGGTTGAAATTAGGTAAAGTAGCTTTA
ATAGGTCTATATTTAGTCCTTTATGCTATGGATAAAGTGCAACTCATTAGATATAGACTTAATACAACCCAATGTCGTCAGAAATCCTAG
GCATATGTAAGAAGAAGGGAATTAGAGTTCCAAGTTTATCATTGGATTTTTGTTAAAGTGTAACCT
(5')ATGAAAGGGTTGATGAGATT
TCCAAAGAAAGTAAATCTTAGTCCTACATATGTAGGCCCTTACAAGATATTTAAAAGGGTTGGACAGGTGGCATATGAGTTAGACTTGCC
AGCAGAATTAGCAACAGTGCATCTGGTCTTCCACATCTCACTCTGGAAGAAGTGTGTGGGCGATTCATCCTCTTCAGTGCCATTAGAGAG
TGTGGCGGTAAAAGATAGTCTTTATGATGAGGATGTAGAGATTATCGATCGTCACCTTAXGAAGGCTTTGAAAAAAGAAGTTGCATCAGT
CAAGGTTTTAGGGAGGAGTAATACTGTAAAGGGAGATTCTTGGGAATCAAAAGCAGCCATGAAAGCCAAGAATCCTTACCTCTTTCCTTC
TGATTCCACTCAAGCTTGA(3')GGTAATATTTCCTCTTAAGTTTCCCTGTTGTTCATGCGTAAATTTAGTCTTAGAATTATTTTCCCTC
TGTGTGTACTTGCATTTTCAACGTATTTTGATGTACTAGGAACTCAATTCAGTCAGAAACTCAGTTTTTAGTGTTTAGTAGTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan