Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U331232

Score 
73
Direction 
Forward
Predicted Peptide Sequence 
MTKEEVKRALIALTEPLKNIVKXGPRVNSLESTMTSRLRYFVQRWDXDPQEFLDCVYKVLNAMDVTSKEKVELCSYQLRKVAQGGTYNGK
KIVRLNPDPIEQDEFKEAFLAKYFFENREDKVEKFISLRQGNMSMDEIFLEIYPIVKYDPSLVSNPRX
Predicted Coding Sequence 
ATGACTAAAGAGGAGGTTAAAAGAGCTCTTATTGCCCTTACCGAGCCACTTAAGAATATAGTGAAGXTGGGGCCTAGGGTGAATTCTCTT
GAGAGTACCATGACTTCTAGGTTGAGGTACTTTGTTCAAAGGTGGGATAXGGATCCCCAAGAGTTTCTAGATTGTGTTTATAAGGTGTTG
AATGCTATGGACGTGACTTCAAAAGAGAAGGTGGAGTTGTGTTCATATCAATTGAGGAAGGTTGCTCAAGGTGGTACATATAATGGAAAG
AAAATAGTCCGGTTGAATCCXGATCCTATAGAACAAGATGAGTTTAAGGAAGCATTCTTAGCAAAGTACTTTTTCGAGAACAGAGAAGAT
AAGGTTGAGAAGTTTATAAGCCTTAGGCAAGGTAACATGAGTATGGATGAAATTTTCCTTGAAATTTACCCTATTGTCAAGTATGATCCA
TCTTTAGTGTCTAACCCTAGGGAX
Edits in Original Sequence 
CTCTCAAGTCAAATCCTCCATTGAAGAAACTTTAAGCTCCAAGGAAGAGGATCAAATTCCCCATGTTTTAACCTAAATTTCGTGGATAGG
TCTTCAATGAGGTGGTGGCAACTGAGGATTCCTAGAGTTGAAGCTTGGGAAGTAGATTTCTCTCAAGATTGGATATGAGTCGAAGGAGGA
CACCTGCATGAAGTGTGAAGAAAGGAGTAGTGAATGAGGGATTTCCTTCCCTAGACAAATAAGTTCCTCAAGATGAAAAAATGCCTACAG
CTAGTTAAGCGAATGAGGTTCTGGTAGTTCCCCTGGAG
(5')ATGACTAAAGAGGAGGTTAAAAGAGCTCTTATTGCCCTaTACCGAGCC
ACTTAAGAATATAGTGAAGXTGGGGCCTAGGGTGAATTCTCTTGAGAGTACCATGACTTCTAGGTTGAGGTACTTTGTTCAAAGGTGGGA
TAXGGATCCCCAAGAGTTTCTAGATTGTGTTTATAAGGTGTTGAATGCTATGGACGTGACTTCAAAAGAGAAGGTGGAGTTGTGTTCATA
TCAATTGAGGAAGGTTGCTCAAGtGTGGTACATATAATGGAAAGAAAATAGTCCGGTTGAATCCXGATCCTATAGAACAAGATGAGTTTA
AGGAAGCATTCTTAGCAAAGTACTTTTTaCGAGAACAGAGAAGATAAGGTTGAGAAGTTTATAAGCCTTAGGCAAGGTAACATGAGTATG
GATGAAATTTTCCTTGAAATTTACCCTATTGTCtAAGTATGATCCATCTTTAGTGTCTAACCCTAGGGAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan