ESTScan Details for Unigene SGN-U331365

Score 
440
Direction 
Forward
Predicted Peptide Sequence 
FLGRSFPPVVEECACKLGTDTTIKVFGKLGRETGLKEYNALIRLCIEKARESNDEEVSLKQLSKAYQLLKSMKEQGFQLKEESYGSILMY
FIDFGMVQDFDFYCELITDGNADSLVRLTYYEMLLWAKVENEDKIEELLYHLSLYDGADKSAFQGLQFTDITPITNLVFILWLFDPAD
Predicted Coding Sequence 
TTCTTAGGTAGGTCGTTTCCACCAGTTGTTGAAGAATGTGCCTGTAAATTGGGGACTGATACTACCATTAAGGTGTTTGGTAAATTGGGA
CGAGAAACTGGCCTGAAAGAATATAATGCGCTGATAAGACTCTGTATAGAGAAGGCCAGAGAAAGTAATGATGAAGAGGTGTCTTTGAAG
CAGCTTTCAAAGGCATATCAACTACTAAAATCAATGAAGGAACAGGGTTTTCAATTAAAAGAGGAGAGCTATGGTTCAATTCTTATGTAT
TTTATTGATTTTGGCATGGTACAAGATTTTGATTTTTACTGTGAGCTCATTACGGATGGAAATGCTGATTCACTTGTGAGATTAACTTAC
TATGAGATGTTGCTTTGGGCTAAGGTGGAAAATGAAGATAAAATAGAAGAACTCCTCTACCATCTTTCTCTTTATGATGGTGCTGATAAA
TCTGCCTTTCAAGGTTTGCAATTTACTGACATTACCCCTATTACAAATTTAGTTTTTATACTCTGGTTGTTTGATCCTGCTGATTAG
Edits in Original Sequence 
(5')TTCTTAGGTAGGTCGTTTCCACCAGTTaGTTGAAGAATGTGCCTGTAAATTGGGGACTGATACTACCATTAAGGTGTTTGGTAAAT
TGGGACGAGAAACTGGCCTGAAAGAATATAATGCGCTGATAAGACTCTGTATAGAGAAGGCCAGAGAAAGTAATGATGAAGAGGTGTCTT
TGAAGCAGCTTTCAAAGGCATATCAACTACTAAAATCAATGAAGGAACAGGGTTTTCAATTAAAAGAGGAGAGCTATGGTTCAATTCTTA
TGTATTTTATTGATTTTGGCATGGTACAAGATTTTGATTTTTACTGTGAGCTCATTACGGATGGAAATGCTGATTCACTTGTGAGATTAA
CTTACTATGAGATGTTGCTTTGGGCTAAGGTGGAAAATGAAGATAAAATAGAAGAACTCCTCTACCATCTTTCTCTTTATGATGGTGCTG
ATAAATCTGCCTTTCAAGGTTTGCAATTTACTGACATaTACCCCTATTACAAATTTAGTTTTTATACTCTGGTTGTTTGATCCTGCTGAT
TAG(3')AAATTACTTGTGGTACCTTGCACTTAATGACTAGTGATAAAAATGATTGAGTTGCATGCCTCTTTTATCATGTTTACTGTACA
TGATATTTATAATGCATTTGCAAATTGTTGATGAATTTAGAGTCTCTTTGCAATGCGGTAACATCTTAGAATCTTACGAATCATTTCTTA
AATGCATCTCATGATGAGTTTTGGCAGATGCTTTACTGTACTATTGCCATATTTTAGACTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan