ESTScan Details for Unigene SGN-U331397

Score 
514
Direction 
Forward
Predicted Peptide Sequence 
HADVDDKGSGGGSGGAGWEERVDNEDTLIQKSKESYYLQLTLAKKLVEQAMLTSGEPILLQECKNIKGLGGSSDAQTVSYRLWVSGSLSY
ADKISDGFYNILGMNPYLWVMCNATEDGKQIPSLMALKGIEPSETSMEVVLIDRRGDSMLRELEDKAQEIYFAADNTLVLAENLGKLVAV
YMGGSFPVEQGDLHQRWKAVSKRLQDLQKCIXATNWQFLLRTLQAQSYSVQEIGRLRRFAL
Predicted Coding Sequence 
CACGCAGACGTCGACGACAAGGGAAGTGGAGGAGGAAGTGGTGGTGCAGGATGGGAGGAGAGAGTTGATAACGAAGATACATTGATACAG
AAGTCGAAGGAGAGCTATTACCTGCAGCTGACGCTCGCTAAAAAGCTTGTAGAGCAAGCAATGCTTACTTCTGGAGAGCCTATTCTTCTG
CAGGAGTGCAAAAATATCAAGGGCCTTGGTGGATCTTCTGATGCTCAAACTGTATCTTATCGTTTATGGGTGAGTGGTTCGTTGTCTTAT
GCTGATAAGATATCTGATGGGTTTTACAACATATTAGGAATGAATCCATATTTGTGGGTTATGTGTAATGCCACAGAGGATGGTAAACAA
ATACCATCTCTAATGGCATTAAAAGGAATTGAACCCAGTGAGACATCAATGGAGGTTGTTCTTATTGATAGGCGTGGGGATTCAATGCTC
AGGGAATTAGAAGATAAAGCTCAAGAAATTTACTTTGCTGCTGACAATACGTTAGTCTTGGCAGAAAACCTTGGCAAGCTTGTGGCTGTC
TATATGGGGGGCTCTTTTCCGGTGGAACAAGGTGATCTTCATCAGCGGTGGAAAGCTGTTAGCAAGAGATTACAAGATCTGCAGAAGTGC
ATTGXTGCTACCAATTGGCAGTTTCTCCTCAGGACTTTGCAGGCACAGAGCTATTCTGTTCAAGAAATTGGCAGATTACGTAGGTTTGCC
TTGTAG
Edits in Original Sequence 
(5')CACGCAGACGTCGACGACAAGGGAAGTGGAGGAGGAAGTGGTGGTGCAGGATGcGGAGGAGAGAGTTGATAACGAAGATACATTGA
TACAGAAGTCGAAGGAGAGCTATTACCTGCAGCTGACGCTCGCTAAAAAGCTTGTAGAGCAAGCAATGCTTACTTCTGGAGAGCCTATTC
TTCTGCAGGAGTGCAAAAATATCAAGGGCCTTGGTGGATCTTCTGATGCTCAAACTGTATCTTATCGTTTATGGGTGAGTGGTTCGTTGT
CTTATGCTGATAAGATATCTGATGGGTTTTACAACATATTAGGAATGAATCCATATTTGTGGGTTATGTGTAATGCCACAGAGGATGGTA
AACAAATACCATCTCTAATGGCATTAAAAGGAATTGAACCCAGTGAGACATCAATGGAGGTTGTTCTTATTGATAGGCGTGGGGATTCAA
TGCTCAGGGAATTAGAAGATAAAGCTCAAGAAATTTACTTTGCTGCTGACAATACGTTAGTCTTGGCAGAAAACCTTGGCAAGCTTGTGG
CTGTCTATATGGGGGGCTCTTTTCCGGTGGAACAAGGTGATCTTCATCAGCGGTGGAAAGCTGTTAGCAAGAGATTACAAGATCTGCAGA
AGTGCATTGXTGCTACCAATTGGCAGTTTCTCCTCAGGACTTTGCAGGCACAGAGCTATTCTGTTCAAGAAATTGGCAGATTACGTAGGT
TTGCCTTGTAG(3')GATAGCTCGAGGTTGCAAGTATTGTGTCGCAGATCACCGGTCTTCTTGTCTGGTAATAATTGAGGACGACAGAAG
ATTGTCAAGGTAAAACATCTTATCCACTATCTCTTCAATCAAAGTAGTTATCTCCTCTAACCATCAACAAGTGTTTTCTCCTTAGCGGTT
TTGGTTTATGTTTCAAATGTATCTCCAACATTTTAATCTGATATAATGTTTGAGACCTCATTATTGGTTACTTCGTACTTGACATTTCTT
TCAGACTTTAATTGTGCTTTCATGAGTATTTAATAAGATTAAAGTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan