Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U331580

Score 
1320
Direction 
Forward
Predicted Peptide Sequence 
LDTKDVEVEPEQAVSGTIYANGAIPEKASSXDVLEVEVSGQTSAISRSITGSEQEGEAKDHIDEEANLEGSVSDGETDGMIFGSSEAAKQ
FMEELERESGGGSYAGAEVSQDIDGQIVTDSDEEADTDEEGDVKELFDSTALAALLKTATGGDSDGGNITVTSQDGSRLFSVERPAGLGS
SLRSLRPAPRPSQPNLFTHSNLQNSGESENNLSEEEKKKLDTLQQIRVKFLRLIHRLGLSSDEPIAAQVLYRMTLIARRQNSPLFSVEAA
KMKAFQLEAEGKDDLDFSVNILVIGKSGVGKSATINSIFGEEKTSIDAFGPATTSVKEISGVVDGVKIRVFDTPGLKSSAMEXGFHRSVL
SSVKKLTKKNPPDIYLYVDRLDX
Predicted Coding Sequence 
XGTCTGGACACCAAGGATGTTGAAGTGGAACCTGAGCAGGCAGTGTCTGGAACTATATATGCCAATGGTGCCATTCCGGAGAAAGCGTCT
AGCGAXGATGTATTGGAAGTTGAAGTCTCTGGCCAAACATCTGCTATATCAAGGTCAATCACTGGCTCAGAGCAAGAAGGAGAAGCTAAA
GATCATATAGATGAAGAAGCTAACCTTGAAGGCTCAGTTTCTGATGGAGAGACAGATGGTATGATTTTTGGAAGCTCTGAAGCTGCCAAA
CAGTTTATGGAGGAGCTGGAAAGGGAATCTGGTGGTGGCTCCTATGCTGGTGCTGAAGTTTCTCAGGATATTGATGGTCAGATTGTCACC
GACTCCGATGAAGAGGCTGATACTGATGAAGAAGGAGATGTGAAGGAGTTGTTTGATTCGACTGCCTTAGCTGCTCTTTTAAAAACAGCA
ACAGGTGGTGATTCTGATGGTGGCAACATAACAGTCACGTCTCAAGATGGATCAAGACTGTTCTCTGTTGAACGTCCTGCTGGTCTTGGG
TCATCACTCCGGTCACTGAGGCCAGCTCCCCGACCAAGCCAACCCAATCTTTTTACTCATTCCAATCTCCAGAACAGTGGAGAATCTGAG
AACAACTTGAGTGAAGAAGAGAAGAAGAAACTGGACACACTACAGCAGATCAGGGTCAAGTTTTTGAGGCTTATTCACAGGTTGGGTCTA
TCTTCTGATGAGCCCATAGCTGCACAAGTTTTGTACCGGATGACACTTATTGCACGAAGGCAAAACAGTCCACTTTTTAGCGTTGAGGCT
GCCAAGATGAAAGCTTTCCAGCTTGAAGCAGAGGGGAAAGATGATTTGGACTTCTCTGTGAATATCCTGGTTATTGGCAAATCTGGGGTG
GGTAAGAGCGCTACCATAAACTCTATCTTTGGAGAGGAAAAAACATCAATTGATGCCTTTGGACCTGCTACCACCAGTGTGAAAGAGATC
AGTGGTGTTGTAGATGGTGTTAAGATTCGGGTGTTTGATACACCTGGCCTCAAGTCCTCTGCGATGGAACANGGNTTTCATCGCAGTGTC
TTGTCTTCAGTAAAGAAGTTGACTAAGAAGAATCCCCCTGATATTTACCTCTATGTCGATCGGTTGGATGXX
Edits in Original Sequence 
(5')XGTCTGGACACCAAGGATGTTGAAGTGGAACCTGAGCAGGCAGTGTCTGGAACTATATATGCCAATGGTGaCCATTCCGGAGAAAG
CGTCTAGCGAXGATGTATTGGAAGTTGAAGTCTCTGGCCAAACATCTGCTATATCAAGGTCAATCACTGGCTCAGAGCAAGAAGGAGAAG
CTAAAGATCATATAGATGAAGAAGCTAACCTTGAAGGCTCAGTTTCTGATGGAGAGACAGATGGTATGATTTTTGGAAGCTCTGAAGCTG
CCAAACAGTTTATGGAGGAGCTGGAAAGGGAATCTGGTGGTGGCTCCTATGCTGGTGCTGAAGTTTCTCAGGATATTGATGGTCAGATTG
TCACCGACTCCGATGAAGAGGCTGATACTGATGAAGAAGGAGATGTGAAGGAGTTGTTTGATTCGACTGCCTTAGCTGCTCTTTTAAAAA
CAGCAACAGGTGGTGATTCTGATGGTGGCAACATAACAGTCACGTCTCAAGATGGATCAAGACTGTTCTCTGTTGAACGTCCTGCTGGTC
TTGGGTCATCACTCCGGTCACTGAGGCCAGCTCCCCGACCAAGCCAACCCAATCTTTTTACTCATTCCAATCTCCAGAACAGTGGAGAAT
CTGAGAACAACTTGAGTGAAGAAGAGAAGAAGAAACTGGACACACTACAGCAGATCAGGGTCAAGTTTTTGAGGCTTATTCACAGGTTGG
GTCTATCTTCTGATGAGCCCATAGCTGCACAAGTTTTGTACCGGATGACACTTATTGCACGAAGGCAAAACAGTCCACTTTTTAGCGTTG
AGGCTGCCAAGATGAAAGCTTTCCAGCTTGAAGCAGAGGGGAAAGATGATTTGGACTTCTCTGTGAATATCCTGGTTATTGGCAAATCTG
GGGTGGGTAAGAGCGCTACCATAAACTCTATCTTTGGAGAGGAAAAAACATCAATTGATGCCTTTGGACCTGCTACCACCAGTGTGAAAG
AGATCAGTGGTGTTGTAGATGGTGTTAAGATTCGGGTGTTTGATACACCTGGCCTCAAGTCCTCTGCGATGGAACANGGNTTTCATCGCA
GTGTCTTGTCTTCAGTAAAGAAGTTGACTAAGAAGAATCCCCCTGATATTTACCTCTATGTCGATCGGTTGGATGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan