Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U331640

Score 
56
Direction 
Reverse
Predicted Peptide Sequence 
IATITFSSXNSPLKPDLVSSSQLSSWHXILVQLIIMSFIQYSSLKSLNQLSGVMFDIVIIGNDQDGITGLKQYIFQHFQTKGXPGLKYFL
GIEFALSKSGIVNSXTEYVLDILEETGITGSRHFRMEGPCSIHTLMDPNAKLLQDRGAPAKIGEPLSDPETYR
Predicted Coding Sequence 
ATTGCGACGATCACTTTCTCGTCTAAXAACAGTCCCCTCAAGCCTGATTTGGTAAGTTCATCTCAATTAAGCAGTTGGCATGAXATTTTA
GTGCAACTGATCATTATGAGTTTTATACAGTATTCTTCTCTTAAGTCTTTGAATCAACTTAGTGGXGTTATGTTTGATATAGTCATTATT
GGCAATGATCAAGATGGTATCACTGGATTGAAGCAATATATCTTTCAGCACTTCCAAACTAAGGGTXTTCCTGGATTGAAGTATTTTCTA
GGTATTGAGTTTGCTCTGTCTAAGTCAGGTATTGTCAATTCAXCAACAGAATATGTACTAGACATTCTTGAGGAGACGGGAATAACAGGA
AGTAGACATTTCCGTATGGAAGGGCCTTGCTCAATTCACACTCTTATGGACCCAAATGCTAAGCTTCTCCAAGATAGGGGAGCTCCTGCA
AAGATAGGGGAGCCCCTTAGTGATCCTGAAACATATAGGTGA
Edits in Original Sequence 
(5')ATTGCGACGATCACTTTCTCGTCTAAXAACAGTCCCCTCAAGCCTGATTTGGTAAGTTCATCTCAATTAAGCAGTTGGCATGAXAT
TTTAGTGCAACTGATCATTATGAGTTTTATACAGTATTCTTCTCTTAAGTCTTTGAATCAACTTAGTGGXGTTATGTTTGATATAGTCAT
TATTGGCAATGATCAAGATGGTATCACTGGATTGAAGCAATATATCTTTCAGCACTTCCAAACTAAGGGTXTTCCTGGATTGAAGTATTT
TCTAGGTATTGAGTTTGCTCTGTCTAAGTCAGGTATTGTCAATTCAXCAACAGAATATGTACTAGACATTCTTGAGGAGACGGGAATAAC
AGGAAGTAGACATTTCCGTATGGAAGGGCtCTTGCTCAATTCACACTCTTATGGACCCAAATGCTAAGCTTCTgCCAAGATAGGGGAGCT
CCTGCAAAGATAGGGGAGCCCCTTAGTGATCCTGAAACATATAGGTGA(3')CTGGTTAGTATGTTGAACTACCTTGTAGTGACTCCTGA
CATTGTTAATCATGTAAGTGTTGTAAGTCTATTTATGGACTGTCCAAGTGCTGGTCATTGGAAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan