ESTScan Details for Unigene SGN-U331786

Score 
2069
Direction 
Forward
Predicted Peptide Sequence 
EHKKLSFEVKKNPKMELVKGVPLLCMLFLLFLFANSALAKRTTYIIHMDKSFMPKAFTSHEQWHSSILETVKLKDTTSGSSINPTRLLYS
YDNAFHGFSAVMSEDELKVLEKLPGFASAYADKMVTLDTTHTFEFLGLSPESGLWPASEYGEDVIVGVIDTGVWPESRSYMDDGMTEIPS
RWRGICEPGQEFSASMCNNKLIGVQYFNKGVKAAYPNTTLSMDSGRDTRGHGTHTSSTVGGNYVEGASFFGYATGTARGVAPRARLAIYK
VVWDEGRFASDVLAGIDKAVADGVDVISISLGFDYVPLYEDPVAIASFGAMEKGVLVSASAGNLVDPPEGLHNGIPWLLTTAAGSIDRVL
SGKLTLGNGQVISGWSTYPVSALVNEFPLIYNESISSCNSTSISSFSNKIIICENAKFPLQIDVIVKSSAIATIYISDDPLIFENEVFEY
PGVVISPEDGAAVISYAKSGAEPVASISFQQTIMRSTPAPVVATYSLRGPSPSYPGILKPDIMAPGSLVLASWIPKGYTTSIYPDIKLSS
EFAMISGTSMACPHSSGIAALLKGAHPEWSPAAIRSAMITTAINIDNTNSPIKDSGLNYSIATPLAMGAGLVNPNFALNPGLIYDATPQD
YINLLCAMKFTRKQILTITRSSTYTCQNASSDLNYPSFIALYTNETGATLSQKFIRTVTNVGDGPANYSINMTVPSNTNISVYPSRLSFS
SKYDKLSYTLTVEYSGNRTGEIVFGSITWVDVLGLHAVTSPIVVAPMIQTW
Predicted Coding Sequence 
GAACACAAGAAACTGAGTTTTGAAGTAAAAAAGAATCCAAAAATGGAATTAGTTAAAGGAGTGCCTCTTCTTTGTATGTTGTTCTTATTA
TTCCTCTTTGCTAATTCAGCATTAGCAAAAAGAACAACTTACATTATTCATATGGATAAGTCATTCATGCCTAAAGCTTTTACTAGTCAT
GAGCAATGGCACTCTTCAATTCTTGAAACTGTCAAGTTGAAAGATACAACAAGTGGAAGTTCTATCAATCCGACAAGGCTACTTTATTCG
TATGACAATGCATTTCATGGATTCAGTGCTGTTATGTCTGAGGATGAATTGAAAGTTCTTGAAAAGTTGCCTGGTTTTGCGTCGGCTTAT
GCTGATAAAATGGTCACTCTTGACACTACTCACACGTTTGAGTTCCTTGGTCTAAGTCCTGAGTCAGGACTATGGCCAGCTTCTGAATAT
GGTGAAGATGTGATTGTTGGTGTCATTGATACTGGAGTATGGCCAGAGAGTCGGAGTTATATGGATGATGGGATGACTGAAATTCCGTCA
AGGTGGAGGGGTATATGCGAGCCTGGACAAGAATTTAGTGCTTCAATGTGTAACAATAAGTTAATTGGTGTTCAATACTTCAACAAAGGA
GTTAAAGCTGCATATCCTAATACCACACTTAGTATGGATTCAGGCAGGGATACACGAGGTCATGGGACGCATACTTCATCAACTGTTGGT
GGAAATTATGTCGAAGGTGCTTCATTCTTTGGCTATGCAACTGGTACAGCAAGAGGGGTCGCGCCACGTGCTAGGCTTGCTATATATAAG
GTCGTTTGGGATGAAGGACGCTTCGCTTCTGATGTGCTTGCTGGTATAGATAAAGCTGTTGCTGATGGTGTTGATGTGATATCCATCTCT
CTGGGATTTGATTATGTTCCATTGTATGAAGACCCTGTTGCCATAGCTTCATTTGGTGCCATGGAGAAAGGCGTTCTTGTTTCCGCTTCT
GCAGGAAATTTAGTTGACCCCCCTGAAGGACTCCACAATGGAATCCCCTGGCTCTTGACTACTGCTGCTGGCTCTATTGATCGTGTCCTC
TCTGGAAAATTGACTCTTGGAAATGGACAAGTGATCAGTGGTTGGTCAACGTACCCTGTTAGCGCCCTTGTCAACGAGTTCCCACTTATC
TACAACGAGTCAATATCGAGTTGCAATTCAACTTCCATATCCAGCTTCAGCAATAAAATCATCATATGCGAAAATGCAAAATTCCCTTTG
CAAATTGATGTCATTGTTAAATCCTCTGCTATTGCTACTATATACATCTCTGATGATCCACTCATTTTCGAGAATGAAGTGTTTGAATAT
CCCGGAGTTGTTATCAGCCCTGAGGATGGTGCAGCTGTGATCAGTTATGCTAAATCTGGTGCCGAACCTGTTGCCAGCATTAGCTTCCAA
CAGACAATCATGAGATCAACACCAGCACCCGTCGTTGCAACTTACTCATTACGAGGTCCTTCGCCAAGCTACCCAGGAATCTTGAAGCCA
GACATAATGGCACCAGGGTCATTAGTCTTGGCATCCTGGATTCCCAAAGGTTATACAACTTCTATATATCCGGATATTAAATTGAGCAGT
GAATTCGCGATGATTTCAGGAACATCCATGGCTTGTCCACATTCCTCTGGCATTGCTGCACTTCTTAAAGGCGCACATCCTGAATGGAGT
CCAGCAGCAATCCGTTCTGCAATGATCACTACTGCCATCAACATTGACAACACCAATTCTCCCATTAAAGATTCAGGCCTAAACTACAGT
ATCGCGACTCCTCTGGCTATGGGAGCAGGGTTAGTTAATCCAAACTTCGCCCTAAACCCAGGCCTTATCTATGATGCCACACCACAAGAC
TACATAAACCTTTTATGCGCCATGAAATTCACTCGCAAGCAAATCTTGACAATCACAAGATCATCAACCTACACTTGTCAAAATGCATCT
TCTGATCTTAACTACCCATCCTTCATCGCGCTGTACACTAATGAAACTGGAGCAACACTGAGTCAAAAGTTCATAAGGACAGTGACAAAC
GTTGGCGATGGTCCTGCTAACTATTCTATAAATATGACCGTGCCATCGAACACAAACATAAGTGTTTATCCTTCAAGATTGTCCTTCAGC
AGCAAGTATGATAAGCTAAGTTATACATTAACAGTTGAATATAGCGGTAACAGAACTGGAGAAATTGTATTCGGATCGATAACTTGGGTG
GATGTACTTGGTCTCCATGCTGTAACAAGTCCAATTGTGGTTGCACCAATGATCCAAACTTGGTAA
Edits in Original Sequence 
(5')GAACACAAGAAACTGAGTTTTGAAGTAAAAAAGAATCCAAAAATGGAATTAGTTAAAGGAGTGCCTCTTCTTTGTATGTTGTTCTT
ATTATTCCTCTTTGCTAATTCAGCATTAGCAAAAAGAACAACTTACATTATTCATATGGATAAGTCATTCATGCCTAAAGCTTTTACTAG
TCATGAGCAATGGCACTCTTCAATTCTTGAAACTGTCAAGTTGAAAGATACAACAAGTGGAAGTTCTATCAATCCGACAAGGCTACTTTA
TTCGTATGACAATGCATTTCATGGATTCAGTGCTGTTATGTCTGAGGATGAATTGAAAGTTCTTGAAAAGTTGCCTGGTTTTGCGTCGGC
TTATGCTGATAAAATGGTCACTCTTGACACTACTCACACGTTTGAGTTCCTTGGTCTAAGTCCTGAGTCAGGACTATGGCCAGCTTCTGA
ATATGGTGAAGATGTGATTGTTGGTGTCATTGATACTGGAGTATGGCCAGAGAGTCGGAGTTATATGGATGATGGGATGACTGAAATTCC
GTCAAGGTGGAGGGGTATATGCGAGCCTGGACAAGAATTTAGTGCTTCAATGTGTAACAATAAGTTAATTGGTGTTCAATACTTCAACAA
AGGAGTTAAAGCTGCATATCCTAATACCACACTTAGTATGGATTCAGGCAGGGATACACGAGGTCATGGGACGCATACTTCATCAACTGT
TGGTGGAAATTATGTCGAAGGTGCTTCATTCTTTGGCTATGCAACTGGTACAGCAAGAGGGGTCGCGCCACGTGCTAGGCTTGCTATATA
TAAGGTCGTTTGGGATGAAGGACGCTTCGCTTCTGATGTGCTTGCTGGTATAGATAAAGCTGTTGCTGATGGTGTTGATGTGATATCCAT
CTCTCTGGGATTTGATTATGTTCCATTGTATGAAGACCCTGTTGCCATAGCTTCATTTGGTGCCATGGAGAAAGGCGTTCTTGTTTCCGC
TTCTGCAGGAAATTTAGTTGACCCCCCTGAAGGACTCCACAATGGAATCCCCTGGCTCTTGACTACTGCTGCTGGCTCTATTGATCGTGT
CCTCTCTGGAAAATTGACTCTTGGAAATGGACAAGTGATCAGTGGTTGGTCAACGTACCCTGTTAGCGCCCTTGTCAACGAGTTCCCACT
TATCTACAACGAGTCAATATCGAGTTGCAATTCAACTTCCATATCCAGCTTCAGCAATAAAATCATCATATGCGAAAATGCAAAATTCCC
TTTGCAAATTGATGTCATTGTTAAATCCTCTGCTATTGCTACTATATACATCTCTGATGATCCACTCATTTTCGAGAATGAAGTGTTTGA
ATATCCCGGAGTTGTTATCAGCCCTGAGGATGGTGCAGCTGTGATCAGTTATGCTAAATCTGGTGCCGAACCTGTTGCCAGCATTAGCTT
CCAACAGACAATCATGAGATCAACACCAGCACCCGTCGTTGCAACTTACTCATTACGAGGTCCTTCGCCAAGCTACCCAGGAATCTTGAA
GCCAGACATAATGGCACCAGGGTCATTAGTCTTGGCATCCTGGATTCCCAAAGGTTATACAACTTCTATATATCCGGATATTAAATTGAG
CAGTGAATTCGCGATGATTTCAGGAACATCCATGGCTTGTCCACATTCCTCTGGCATTGCTGCACTTCTTAAAGGCGCACATCCTGAATG
GAGTCCAGCAGCAATCCGTTCTGCAATGATCACTACTGCCATCAACATTGACAACACCAATTCTCCCATTAAAGATTCAGGCCTAAACTA
CAGTATCGCGACTCCTCTGGCTATGGGAGCAGGGTTAGTTAATCCAAACTTCGCCCTAAACCCAGGCCTTATCTATGATGCCACACCACA
AGACTACATAAACCTTTTATGCGCCATGAAATTCACTCGCAAGCAAATCTTGACAATCACAAGATCATCAACCTACACTTGTCAAAATGC
ATCTTCTGATCTTAACTACCCATCCTTCATCGCGCTGTACACTAATGAAACTGGAGCAACACTGAGTCAAAAGTTCATAAGGACAGTGAC
AAACGTTGGCGATGGTCCTGCTAACTATTCTATAAATATGACCGTGCCATCGAACACAAACATAAGTGTTTATCCTTCAAGATTGTCCTT
CAGCAGCAAGTATGATAAGCTAAGTTATACATTAACAGTTGAATATAGCGGTAACAGAACTGGAGAAATTGTATTCGGATCGATAACTTG
GGTGGATGTACTTGGTCTCCATGCTGTAACAAGTCCAATTGTGGTTGCACCAATGATCCAAACTTGGTAA(3')TCACAAAAAAAAAAAA
AAAAAAAAAAGAAGAAGGTATATAAAGAACTAGAGTAAAATAACAAAATCTGAGGAATTTAGAGTCATTCTTCTTTTTAAGTTACTGTTT
CTTTGTTTGATTTTGATATACGTTAGTAGAGTCGTGAAGGTTGCATTACCTTCCTTAAAACATCACATTAGGATTACGTCGAGTATGTTG
TTATGATTTATTTATGAATGACCATCCGTCCAGCAGACACTTTTTTTCTAATTGTTAATCTATTCATATATATAATTGATCTAAGTTCAC
ATTAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan