Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U331969

Score 
145
Direction 
Reverse
Predicted Peptide Sequence 
HWYVKSXDLSSNNMVGEIXIEIXISVGFARFEPVEQQLNGQIPLRIGEMKALNFLDLSTNDLTGEIPASLSQLSHLGVLNLSCNNLSGRI
PLGEQLLTFNNRSYIGNHGLCGYPLTEACSLEELPRDSTLSDEDEFITPEFYISMGISFISAFLGVSAHESSYKSRVLETLHLPEFLFDV
HCTPHESANPXNIYTVRVVYLTFMSFSQAKPFIXKEHHRSSECKQEQTSSSASHLELNIDS
Predicted Coding Sequence 
CATTGGTATGTAAAGAGCNTCGATCTTTCAAGCAACAACATGGTGGGAGAAATCCNTATTGAAATTAXCATCTCTGTAGGGTTTGCACGG
TTTGAACCTGTCGAGCAACAACTTAACGGGCAGATCCCTCTGAGGATTGGTGAAATGAAGGCACTGAATTTCCTAGACTTAAGTACAAAT
GATCTTACAGGGGAAATTCCTGCTAGCCTTTCACAGTTAAGTCACTTGGGAGTCTTGAACTTGTCTTGCAACAACTTGTCTGGTCGAATC
CCTTTAGGCGAACAGTTACTAACTTTCAACAACAGATCCTACATTGGCAATCATGGTCTTTGCGGCTATCCACTAACAGAAGCTTGCTCT
CTGGAGGAACTTCCTCGAGACTCAACGTTGAGTGATGAGGACGAGTTTATAACTCCAGAATTTTATATTAGTATGGGAATCAGCTTTATT
TCTGCATTTTTGGGAGTCTCAGCTCATGAAAGTAGCTATAAATCTCGAGTTCTTGAAACTTTGCATTTGCCTGAATTTTTATTCGATGTG
CATTGTACACCACACGAATCAGCTAATCCTCXGAATATTTATACTGTACGAGTTGTTTATTTAACCTTTATGTCGTTTTCTCAAGCAAAA
CCATTCATTXTTAAGGAGCACCATAGATCATCTGAGTGCAAGCAAGAGCAAACCTCATCCTCTGCCTCCCATTTGGAACTCAATATTGAT
AGC
Edits in Original Sequence 
(5')CATTGGTATGTAAAGAGCNTCGATCTTTCAAGCAACAACATGGTGGGAGAAATCCNTATTGAAATTAXCATCTCTGTAGGGTTTGC
ACGGTTTGAACCTGTCGAGCAACAACTTAACGGGCAGcATCCCTCTGAGGATTGGTGAAATGAAGGCACTGAATTTCCTAGACTTAAGTA
CAAATGATCTTACAGGGGAAATTCCTGCTAGCCTTTCACAGTTAAGTCACTTGGGAGTCTTGAACTTGTCTTGCAACAACTTGTCTGGTC
GAATCCCTTTAGGCGAACAGTTACTAACTTTCAACAACAGATCCTACATTGGCAATCATGGTCTTTGCGGCTATCCACTAACAGAAGCTT
GCTCTCTGGAGGAACTTCCTCGAGACTCAACGTTGAGTGATGAGGACGAGTTTATAACTCCAGAATTTTATATTAGTATGGGAATCAGCT
TTATTTCTGCATTTTTGGGAGTCTCAGCTCATGAtAAGTAGCTATAtAATCTCGAGTTCTTGAAACTTTGCATTTGCCTGAATTTTTATT
CGATGTGCATTGTACACCACACGAATCAGCTAATCCTCXGAATATTTATACTGTACGAGTTGTTTATTTAACCTTTATGTCGTTTTCTCA
AGCAAAACCATTCATTXTTAAGGAGCACCATAGATCATCTGAGTGCAAGCAAGAGCAAACCTCATCCTCTGCCTCCCATTTGGAACTCAA
TATTGATAGC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan