ESTScan Details for Unigene SGN-U332243

Score 
583
Direction 
Forward
Predicted Peptide Sequence 
KVEAMSERVLCKFFAHGACLKGDHCEFSHDWNNPSNNVCTYYQKGACAYGSRCRYDHVKLSRSQPSAQSSAQPQQCLLSSSTPINVSPGM
GAHNADVLPGICTEYLASSRPYDASSQSAWNQKSELQDALEIDDMIELNSDNPADRSICAFAAAGNCPRGEKCPRVHGDLCPTCGKHCLH
PFRPEEREEHIKTCENKQKHLDLLKRSQEIECSVCLERVLSKSTAAERKFGILSECDHPFCVSCIRNWRGSSSSGMDVNSALRACPICRK
LSYFVIPSVIWYFTKEEKEEIVDNYKNKLRSIX
Predicted Coding Sequence 
XCAAAGGTGGAAGCCATGTCCGAAAGGGTTCTTTGCAAGTTCTTTGCACATGGGGCATGTCTGAAGGGGGATCATTGTGAGTTTTCACAT
GATTGGAACAATCCTTCTAATAATGTATGTACCTACTACCAAAAAGGAGCTTGTGCTTATGGAAGCAGGTGTAGATATGATCATGTTAAA
CTGTCTCGATCACAACCTTCAGCTCAGTCTTCAGCACAACCTCAACAATGTCTGCTTTCAAGTTCTACGCCTATCAATGTGTCTCCTGGA
ATGGGTGCACATAATGCAGATGTTCTGCCAGGCATTTGTACTGAGTATTTAGCTTCAAGCAGACCTTATGACGCTTCCAGCCAATCAGCA
TGGAACCAAAAGTCAGAGCTTCAAGATGCATTAGAGATTGATGACATGATTGAGTTAAACAGTGATAATCCAGCTGATCGGTCAATCTGT
GCTTTTGCTGCTGCTGGTAATTGTCCTCGGGGAGAAAAGTGTCCTCGTGTTCATGGAGATCTGTGTCCAACCTGCGGAAAGCATTGCTTG
CATCCTTTCAGGCCCGAGGAAAGAGAGGAGCATATAAAAACATGTGAGAACAAGCAAAAGCACCTTGATTTATTGAAGCGCAGTCAAGAA
ATAGAATGCAGTGTATGCCTTGAACGCGTTCTTTCCAAGTCAACAGCAGCTGAGAGGAAGTTTGGGATCCTTTCTGAGTGTGATCATCCA
TTTTGTGTATCGTGTATAAGGAATTGGCGTGGCAGTTCTTCCTCTGGGATGGATGTTAATTCTGCACTGAGGGCGTGTCCCATATGCAGA
AAGCTTTCATATTTTGTCATTCCAAGTGTTATTTGGTACTTCACAAAAGAAGAGAAGGAAGAAATAGTTGACAACTACAAAAACAAACTC
AGATCTATTGAX
Edits in Original Sequence 
(5')XCAAAGGTGGAAGCCATGTCCGAAAGGGTTCTTTGCAAGTTCTTTGCACATGGGGCATGTCTGAAGGGGGATCATTGTGAGTTTTC
ACATGATTGGAACAATCCTTCTAATAATGTATGTACCTACTACCAAAAAGGAGCTTGTGCTTATGGAAGCAGGTGTAGATATGATCATGT
TAAACTGTCTCGATCACAACCTTCAGCTCAGTCTTCAGCACAACCTCAACAATGTCTGCTTTCAAGTTCTACGCCTATCAATGTGTCTCC
TGGAATGGGTGCACATAATGCAGATGTTCTGCCAGGCATTTGTACTGAGTATTTAGCTTCAAGCAGACCTTATGACGCTTCCAGCCAATC
AGCATGGAACCAAAAGTCAGAGCTTCAAGATGCATTAGAGATTGATGACATGATTGAGTTAAACAGTGATAATCCAGCTGATCGGTCAAT
CTGTGCTTTTGCTGCTGCTGGTAATTGTCCTCGGGGAGAAAAGTGTCCTCGTGTTCATGGAGATCTGTGTCCAACCTGCGGAAAGCATTG
CTTGCATCCTTTCAGGCCCGAGGAAAGAGAGGAGCATATAAAAACATGTGAGAACAAGCAAAAGCACCTTGATTTATTGAAGCGCAGTCA
AGAAATAGAATGCAGTGTATGCCTTGAACGCGTTCTTTCCAAGTCAACAGCAGCTGAGAGGAAGTTTGGGATCCTTTCTGAGTGTGATCA
TCCATTTTGTGTATCGTGTATAAGGAATTGGCGTGGCAGTTCTTCCTCTGGGATGGATGTTAATTCTGCACTGAGGGCGTGTCCCATATG
CAGAAAGCTTTCATATTTTGTCATTCCAAGTGTTATTTGGTACTTCACAAAAGAAGAGAAGGAAGAAATAGTTGACAACTACAAAAACAA
ACTCAGATCTATTGAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan