ESTScan Details for Unigene SGN-U332491

Score 
426
Direction 
Forward
Predicted Peptide Sequence 
LIPESSSSHIQYSPGGLIYKPGGSNLQHATTITFLLLVYANYLEKSSQILNCGTISVSPSMLRKIGKRQVDYILGENPKGISYMVGYSNY
YPQKIHHRGSTIPSIKDHPQVIGCNEGSIYFNSSQPNPNVLVGAIVGGPGEDDVYDDNRDEFRKSEPTTYINAPFVGALAYFAANPNVN
Predicted Coding Sequence 
XXATTAATCCCAGAATCATCATCTTCTCATATACAATACTCTCCTGGTGGACTAATTTACAAGCCTGGTGGAAGCAATTTACAACATGCC
ACAACAATCACATTCCTACTACTAGTCTACGCAAATTACTTAGAAAAATCATCACAAATATTGAATTGTGGTACTATAAGTGTGAGTCCA
TCGATGCTTCGAAAAATTGGTAAGAGACAAGTCGATTACATTTTAGGTGAAAATCCTAAAGGTATATCATACATGGTTGGTTATAGTAAT
TACTATCCTCAAAAAATTCATCATCGCGGATCGACTATTCCATCGATCAAAGATCATCCTCAGGTCATTGGATGCAACGAGGGCTCGATT
TATTTTAACTCATCGCAGCCTAATCCAAATGTTTTAGTTGGTGCAATTGTTGGTGGTCCTGGAGAAGATGATGTTTATGATGATAATAGA
GATGAATTTCGTAAATCTGAGCCAACTACTTATATTAATGCACCATTTGTTGGTGCACTTGCTTACTTTGCAGCTAATCCTAACGTTAAT
TAG
Edits in Original Sequence 
(5')XXATTAATCCCAGAATCATCATCTTCTCATATACAATACTCTCCTGGTGGACTAATTTACAAGCCTGGTGGAAGCAATTTACAACA
TGCCACAACAATCACATTCCTACTACTAGTCTACGCAAATTACTTAGAAAAATCATCACAAATATTGAATTGTGGTACTATAAGTGTGAG
TCCATCGATGCTTCGAAAAATTGGTAAGAGACAAGTCGATTACATTTTAGGTGAAAATCCTAAAGGTATATCATACATGGTTGGTTATAG
TAATTACTATCCTCAAAAAATTCATCATCGCGGATCGACTATTCCATCGATCAAAGATCATCCTCAGGTCATTGGATGCAACGAGGGCTC
GATTTATTTTAACTCATCGCAGCCTAATCCAAATGTTTTAGTTGGTGCAATTGTTGGTGGTCCTGGAGAAGATGATGTTTATGATGATAA
TAGAGATGAATTTCGTAAATCTGAGCCAACTACTTATATTAATGCACCATTTGTTGGTGCACTTGCTTACTTTGCAGCTAATCCTAACGT
TAATTAG(3')ATGATCACCATACCTAATTTAATATTATGGTGATGCATTGTATATATAATTAAATAGTCTCTCATCTTGCACATGCAAA
GAAGGAAGAGGCTTTTTTTTTTCCTTGTTAATTTGGATTTTAAATGATGTGAGAATGTATTGTCACAATGACTTATTGTGACATTTTATA
TAGAGTGAGTATATTATTATTAAGTTGTTCGAGTTTTTAACATGTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan