ESTScan Details for Unigene SGN-U332662

Score 
621
Direction 
Forward
Predicted Peptide Sequence 
IDAVIDPLSSSGQKXVFSSSACVKVRSAKHEACTQPHEFTVDLPLKNYYRYVIPTLDDFSSTDYTIYGPKAFFANMPPSKTLTMNLDVPE
PWLVEPVVAVHDLDNMLLENLGETRTLQAVYELEALVLTGHCSEKDQEPPRGLQLILGTKSTPHLVDTLVMANLGYWQMKAFPGVWYLQL
APGRSSELYALKDDGDGGQETTLSKRIIIDDLRGKLVHMEVIKKKGKEHEKLLVSADX
Predicted Coding Sequence 
XATATTGATGCTGTCATTGACCCCTTGAGCTCATCTGGTCAAAAGXTTGTCTTCTCTTCTTCGGCTTGTGTCAAAGTCCGTTCGGCCAAG
CATGAGGCTTGTACTCAACCCCATGAGTTCACTGTTGATCTTCCATTGAAGAACTACTACAGATATGTTATACCAACACTGGATGACTTT
AGTAGTACAGATTACACCATTTATGGTCCCAAAGCGTTTTTTGCTAATATGCCACCTTCTAAGACGCTAACTATGAATCTTGATGTTCCT
GAGCCATGGCTCGTTGAGCCTGTAGTTGCTGTCCATGACCTAGATAATATGTTGCTTGAAAACCTGGGAGAGACTAGGACACTCCAAGCA
GTGTATGAACTTGAAGCACTAGTCCTGACAGGTCATTGCTCTGAGAAGGATCAGGAGCCTCCTAGAGGACTTCAGCTAATCCTAGGCACT
AAAAGTACACCTCACTTGGTTGACACACTTGTCATGGCCAATTTGGGTTACTGGCAAATGAAAGCGTTTCCTGGAGTTTGGTACCTGCAG
CTTGCTCCTGGTCGAAGCTCAGAGCTTTATGCTTTGAAAGATGATGGTGATGGTGGTCAGGAGACAACTTTGTCAAAACGGATCATTATA
GATGATTTGCGTGGTAAACTTGTTCACATGGAAGTGATTAAGAAAAAGGGCAAGGAACATGAAAAACTGTTGGTTTCAGCTGATGXX
Edits in Original Sequence 
(5')XATATTGATGCTGTCATTGACCCCTTGAGCTCATCTGGTCAAAAGXTTGTCTTCTCTTCTTCGGCTTGTGTCAAAGTCCGTTCGGC
CAAGCATGAGGCTTGTACTCAACCCCATGAGTTCACTgGTTGATCTTCCATTGAAGAACTACTACAGATATGTTATACCAACACTGGATG
ACTTTAGTAGTACAGATTACACCATTTATGGTCCCAAAGCGTTTTTTGCTAATATGCCACCTTCTAAGACGCTAACTATGAATCTTGATG
TTCCTGAGCCATGGCTCGTTGAGCCTGTAGTTGCTGTCCATGACCTAGATAATATGTTGCTTGAAAACCTGGGAGAGACTAGGACACTCC
AAGCAGTGTATGAACTTGAAGCACTAGTCCTGACAGGTCATTGCTCTGAGAAGGATCAGGAGCCTCCTAGAGGACTTCAGCTAATCCTAG
GCACTAAAAGTACACCTCACTTGGTTGACACACTTGTCATGGCCAATTTGGGTTACTGGCAAATGAAAGCGTTTCCTGGAGTTTGGTACC
TGCAGCTTGCTCCTGGTCGAAGCTCAGAGCTTTATGCTTTGAAAGATGATGGTGATGGTGGTCAGGAGACAACTTTGTCAAAACGGATCA
TTATAGATGATTTGCGTGGTAAACTTGTTCACATGGAAGTGATTAAGAAAAAGGGCAAGGAACATGAAAAACTGTTGGTTTCAGCTGATG
XX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan