ESTScan Details for Unigene SGN-U332781

Score 
336
Direction 
Forward
Predicted Peptide Sequence 
EEGINLYRLHTNKHGRLESTKGTFVKEWVKWEKQLRDILHGNADYLNSIQLAKKDPKVGDFLKDKSLESCIQKAHLTLAHKRSHGVTAVA
NYGSFFTKXVPVDVAALLFSDKLAALEAEPGSVEGEKVNSKNPWPHVTIWTGAGATAKDANTLPQLLSQGKAIRIAINPPVTITGTXRIL
LNSTCNSSSCVDLPNVNPTWVLSEYHVMTLPSCRNNFVGSCALAXIAVLQLQDRNRFRENVKMLRQ
Predicted Coding Sequence 
GAGGAGGGAATCAATCTGTACAGGCTTCATACTAACAAACATGGAAGATTGGAGTCTACAAAAGGGACTTTTGTAAAAGAGTGGGTTAAA
TGGGAGAAGCAATTGAGGGATATTCTACATGGAAATGCGGACTATCTCAATTCAATACAGCTAGCCAAGAAAGATCCGAAGGTTGGTGAT
TTCTTGAAGGACAAAAGCCTGGAGAGCTGCATTCAGAAGGCTCATTTGACCCTAGCTCACAAGAGAAGTCATGGTGTCACTGCAGTTGCC
AATTACGGTTCCTTCTTCACCAAAAXCGTCCCAGTAGACGTGGCTGCTTTGTTGTTCTCCGATAAATTGGCTGCCCTAGAAGCTGAGCCT
GGTTCTGTCGAAGGTGAAAAGGTCAATTCTAAAAACCCATGGCCCCACGTCACAATATGGACTGGGGCAGGAGCTACAGCCAAAGATGCC
AATACACTACCACAGTTACTTTCTCAAGGGAAGGCTATCCGCATTGCGATAAATCCACCCGTCACTATAACTGGCACTXCTCGAATTCTT
TTGAACTCTACATGTAATTCCTCATCTTGTGTGGATTTACCTAATGTAAACCCTACATGGGTTCTGAGTGAATATCATGTAATGACACTC
CCGAGTTGTAGGAACAATTTTGTAGGATCGTGCGCTTTGGCTXATATAGCAGTCTTGCAGTTGCAGGATAGAAATAGATTTAGAGAAAAT
GTAAAGATGTTGAGGCAATAA
Edits in Original Sequence 
(5')GAGGAGGGAATCAATCTGTACAGGCTTCATACTAACAAACATGGAAGATTGGAGTCTACAAAAGGGACTTTTGTAAAAGAGTGGGT
TAAATGGGAGAAGCAATTGAGGGATATTCTACATGGAAATGCGGACTATCTCAATTCAATACAGCTAGCCAAGAAAGATCCGAAGGTTGG
TGATTTCTTGAAGGACAAAAGCCTGGAGAGCTGCATTCAGAAGGCTCATTTGACCCTAGCTCACAAGAGAAGTCATGGTGTCACTGCAGT
TGCCAATTACGGTTCCTTCTTCACCAAAAXCGTCCCAGTAGACGTGGCTGCTTTGTTGTTCTCCGATAAATTGGCTGCCCTAGAAGCTGA
GCCTGGTTCTGTCGAAGGTGAAAAGGTCAATTCTAAAAACCCATGGCCCCACGTCACAATATGGACTGGGGCAGGAGCTACAGCCAAAGA
TGCCAATACACTACCACAGTTACTTTCTCAAGGGAAGGCTATCCGCATTGCGATAAATCCACCCGTCACTATAACTGGCACTXCTCGAAT
TCTTTTGAACTCTACATGTAATTCCTCATCTTGTGTGGATTTACCTAATGTAAACCCTACATGGGTTCTGAGTGAATATCATGTAATGAC
ACTCCCGAGTTGTAGGAACAATTTTGTAGGATCGTGCGCTTTGGCTXATATAGCAGTCTTGCAGTTGCAGGATAGAAATAGATTTAGAGA
AAATGTAAAGATGTTGAGGCAATAA(3')AGGTCTTAAGTCGTGGGCGTTTTGAAATCCCCGATGGCATTTCTTGAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan