ESTScan Details for Unigene SGN-U332800

Score 
413
Direction 
Forward
Predicted Peptide Sequence 
MANVMKPLMNWPKWHHYLYVRASFIHFVQSQSQSPLFSTCNVRRLPSFTASPSGYRQAHFRSGAALKSRESPLPLDQSEGDSDSDEKTRK
SRNEKKREARRAVRWAMDLAKFSAPQIKRILRVASTEQEVYEAVMLAKRLGPDVREGKRRQFSYIGRLLREVKPELMDGLIQATKDGDQT
KFQALSGSELSATEDVDEEVEETEYEDDEESSEDNIALADRWFDGLVNKDVDISKESIXLSEVDFDRPGVRGLVRNVQSI
Predicted Coding Sequence 
ATGGCTAATGTAATGAAGCCTCTGATGAATTGGCCAAAATGGCATCACTATTTATACGTTCGCGCTTCATTCATCCACTTTGTTCAATCT
CAATCTCAATCTCCACTCTTCTCAACCTGCAATGTTCGCCGACTGCCGTCGTTCACGGCATCACCTTCCGGTTACCGGCAAGCTCATTTT
CGTTCCGGCGCGGCACTTAAATCACGTGAAAGTCCATTACCGTTAGATCAATCAGAGGGCGACAGCGATTCCGATGAAAAAACAAGGAAG
AGTCGTAACGAGAAGAAGCGTGAAGCTCGACGCGCCGTCCGGTGGGCTATGGATTTAGCTAAGTTCTCTGCTCCTCAAATTAAGCGCATT
CTCAGAGTGGCTTCAACGGAGCAAGAGGTATACGAAGCCGTTATGCTGGCCAAGAGACTAGGTCCTGATGTACGAGAAGGAAAGCGAAGG
CAATTCAGTTACATAGGTAGATTATTGCGAGAAGTTAAGCCTGAATTGATGGATGGTTTAATTCAGGCAACAAAAGATGGAGACCAAACT
AAATTTCAGGCTTTATCTGGTTCGGAACTTTCGGCTACCGAAGATGTTGATGAGGAAGTTGAAGAGACTGAATATGAGGATGACGAAGAG
AGTTCTGAGGACAATATTGCTTTAGCCGATAGATGGTTTGATGGCTTGGTCAATAAGGACGTTGACATCTCTAAAGAATCTATTXCTCTA
AGTGAGGTTGATTTTGATCGCCCAGGAGTACGTGGTCTTGTTAGGAATGTACAATCAATA
Edits in Original Sequence 
CAAAA(5')ATGGCTAATGTAATGAAGCCTCTGATGAATTGGCCAAAATGGCATCACTATTTATACGTTCGCGCTTCATTCATCCACTTT
GTTCAATCTCAATCTCAATCTCCACTCTTCTCAACCTGCAATGTTCGCCGACTGCCGTCGTTCACGGCATCACCTTCCGGTTACCGGCAA
GCTCATTTTCGTTCCGGCGCGGCACTTAAATCACGTGAAAGTCCATTACCGTTAGATCAATCAGAGGGCGACAGCGATTCCGATGAAAAA
ACAAGGAAGAGTCGTAACGAGAAGAAGCGTGAAGCTCGACGCGCCGTCCGGTGGGCTATGGATTTAGCTAAGTTCTCTGCTCCTCAAATT
AAGCGCATTCTCAGAGTGGCTTCAACGGAGCAAGAGGTATACGAAGCCGTTATGCTGGCCAAGAGACTAGGTCCTGATGTACGAGAAGGA
AAGCGAAGGCAATTCAGTTACATAGGTAGATTATTGCGAGAAGTTAAGCCTGAATTGATGGATGGTTTAATTCAGGCAACAAAAGATGGA
GACCAAACTAAATTTCAGGCTTTATCTGGTTCGGAACTTTCGGCTACCGAAGATGTTGATGAGGAAGTTGAAGAGACTGAATATGAGGAT
GACGAAGAGAGTTCTGAGGACAATATTGCTTTAGCCGATAGATGGTTTGATGGCTTGGTCAATAAGGACGTTGACATCTCTAAAGAATCT
ATTXCTCTAAGTGAGGTTGATTTTGATCGCCCAGGAGTACGTGGTCTTGTTAGGAATGTACAATCAATA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan