ESTScan Details for Unigene SGN-U332808

Score 
463
Direction 
Forward
Predicted Peptide Sequence 
MASKGIAIICMAFVPIIIAMISVQVAMAQSDCTSTLITMASCLSFVTGSAKTPSASCCSALSGVLQSKPRCLCVIVNGGGSSLGVQINQT
QALALPSACNLQTPPVSKCYEGAPTERAPDSSTGIAVSGSKASGSSIMSDGSSLKVPVRAAAGIVLFMASYVFMI
Predicted Coding Sequence 
ATGGCTTCAAAAGGAATTGCTATAATTTGCATGGCTTTTGTCCCAATTATCATTGCCATGATTTCAGTACAAGTAGCCATGGCTCAATCT
GATTGTACAAGTACACTTATTACTATGGCTTCATGCCTTAGCTTTGTCACCGGAAGTGCGAAAACGCCATCGGCTTCTTGCTGCTCCGCC
CTCTCCGGGGTGTTGCAGTCTAAGCCACGGTGCCTTTGCGTCATTGTCAACGGTGGCGGTTCATCGTTAGGAGTCCAAATTAATCAAACT
CAAGCACTTGCATTGCCTAGTGCATGCAATTTACAAACTCCACCCGTTAGTAAATGTTACGAGGGTGCACCTACAGAAAGAGCTCCAGAT
TCTTCGACTGGTATAGCTGTCTCAGGCTCAAAAGCATCAGGAAGCAGCATCATGTCTGATGGAAGTTCTCTAAAGGTTCCGGTTCGAGCT
GCTGCTGGAATCGTTCTTTTCATGGCTTCCTACGTTTTCATGATTTAA
Edits in Original Sequence 
GACAAGCTAAGCCATATTCATCATTTCCTTATAAGCCACAAAAGATAATATGGGTATTTTTCTCCAAGT(5')ATGGCTTCAAAAGGAAT
TGCTATAATTTGCATGGCTTTTGTCCCAATTATCATTGCCATGATTTCAGTACAAGTAGCCATGGCTCAATCTGATTGTACAAGTACACT
TATTACTATGGCTTCATGCCTTAGCTTTGTCACCGGAAGTGCGAAAACGCCATCGGCTTCTTGCTGCTCCGCCCTCTCCGGGGTGTTGCA
GTCTAAGCCACGGTGCCTTTGCGTCATTGTCAACGGTGGCGGTTCATCGTTAGGAGTCCAAATTAATCAAACTCAAGCACTTGCATTGCC
TAGTGCATGCAATTTACAAACTCCACCCGTTAGTAAATGTTACGAGGGTGCACCTACAGAAAGAGCTCCAGATTCTTCGACTGGTATAGC
TGTCTCAGGCTCAAAAGCATCAGGAAGCAGCATCATGTCTGATGGAAGTTCTCTAAAGGTTCCGGTTCGAGCTGCTGCTGGAATCGTTCT
TTTCATGGCTTCCTACGTTTTCATGATTTAA(3')AGTTTATGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan