ESTScan Details for Unigene SGN-U332823

Score 
397
Direction 
Forward
Predicted Peptide Sequence 
LVSSDDIESIRMDLSEIGRSFRSSFRRQTSILRSNSALSASEKDDVVDEENMLAWAAIERLPTYDRLRSSVFEEVNGNEANVKTKRVTDV
TKLGAVERHVFIEKMIKHIEHDNLQLLHKIRKRIDKVGVKLPTVEVRYKNLTIEAECELVHGKPLPTLWNSLKSTIMNLARLPGLQSEMA
KINIINDVSGVIKPGRMTLLLGPPGCGKTTLLKALSGNLDNSLKVSGEISYNGYKLEEVDHXKLXAYISQNDLHIPEMTVREX
Predicted Coding Sequence 
CTTGTTAGTTCGGACGATATAGAGTCGATTAGAATGGATCTCTCAGAGATTGGAAGAAGCTTTAGATCATCATTTAGGCGCCAGACTTCG
ATTTTGAGGAGTAATTCAGCTTTGAGTGCTTCTGAAAAGGACGACGTTGTGGATGAGGAGAACATGTTGGCTTGGGCAGCAATTGAGAGA
CTGCCAACGTATGACAGGTTGAGATCATCTGTATTTGAGGAAGTCAATGGCAATGAGGCCAATGTTAAGACGAAAAGAGTAACTGATGTT
ACCAAGCTTGGAGCTGTAGAAAGGCATGTTTTCATTGAAAAGATGATTAAACACATTGAACATGACAACCTTCAATTGTTGCACAAAATC
AGAAAGAGAATTGACAAAGTTGGTGTAAAATTGCCTACTGTGGAAGTGAGATACAAAAATTTAACCATTGAAGCAGAATGTGAGCTAGTT
CATGGAAAGCCTCTCCCTACTCTTTGGAATTCTCTCAAAAGCACAATAATGAACCTTGCCAGGCTTCCAGGCCTACAGTCAGAAATGGCC
AAGATAAATATCATTAATGATGTCAGCGGTGTAATAAAACCCGGACGTATGACTCTACTGCTTGGACCTCCTGGGTGTGGAAAAACAACA
CTGCTGAAAGCACTTTCAGGAAATCTGGACAATTCTCTTAAGGTTTCTGGGGAGATTTCTTATAACGGCTATAAATTGGAGGAAGTTGAC
CACAGNAAACTTXCTGCATATATAAGCCAAAATGACCTACACATCCCTGAAATGACTGTTAGAGAAAXX
Edits in Original Sequence 
(5')CTTGTTAGTTCGGACGATATAGAGTCGATTAGAATGGATCTCTCAGAGATTGGAAGAAGCTTTAGATCATCATTTAGGCGCCAGAC
TTCGATTTTGAGGAGTAATTCAGCTTTGAGTGCTTCTGAAAAGGACGACGTTGTGGATGAGGAGAACATGTTGGCTTGGGCAGCAATTGA
GAGACTGCCAACGTATGACAGGTTGAGATCATCTGTATTTGAGGAAGTCAATGGCAATGAGGCCAATGTTAAGACGAAAAGAGTAACTGA
TGTTACCAAGCTTGGAGCTGTAGAAAGGCATGTTTTCATTGAAAAGATGATTAAACACATTGAACATGACAACCTTCAATTGTTGCACAA
AATCAGAAAGAGAATTGACAAAGTTGGTGTAAAATTGCCTACTGTGGAAGTGAGATACAAAAATTTAACCATTGAAGCAGAATGTGAGCT
AGTTCATGGAAAGCCTCTCCCTACTCTTTGGAATTCTCTCAAAAGCACAATAATGAACCTTGCCAGGCTTCCAGGCCTACAGTCAGAAAT
GGCCAAGATAAATATCATTAATGATGTCAGCGGTGTAATAAAACCCGGACGTATGACTCTACTGCTTGGACCTCCTGGGTGTGGAAAAAC
AACACTGCTGAAAGCACTTTCAGGAAATCTGGACAATTCTCTTAAGGTTTCTGGGGAGATTTCTTATAACGGCTATAAATTGGAGGAAGT
TGACCACAGNAAACTTXCTGCATATATAAGCCAAAATGACCTACACATCCCTGAAATGACTGTTAGAGAAAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan