ESTScan Details for Unigene SGN-U332856

Score 
206
Direction 
Reverse
Predicted Peptide Sequence 
AVFEKEKGEFKIRVVKQIFWVNGMRYELQEIYGIGNSVDKDFDGNDNGKECVVCLSEPRDTTXTSMPTHVHVQWMCTSFEVPNKSLSYLS
QPVERFLEIKVSEAAEE
Predicted Coding Sequence 
XAGGCAGTTTTTGAAAAGGAGAAAGGCGAATTCAAAATTAGGGTGGTGAAGCAAATCTTCTGGGTCAATGGCATGAGGTATGAATTGCAA
GAGATTTATGGCATTGGGAATTCAGTTGATAAGGACTTTGATGGAAATGATAATGGGAAGGAATGTGTCGTATGCCTTTCTGAACCTCGA
GACACTACTGXTACTTCCATGCCGACACATGTGCATGTGCAGTGGATGTGCACAAGTTTTGAGGTTCCAAACAAATCGTTGTCCTATTTG
TCTCAGCCAGTTGAGCGATTCTTGGAGATTAAGGTCAGCGAAGCTGCTGAAGAGTAA
Edits in Original Sequence 
(5')XAGGCAGTTTTTGAAAAGGAGAAAGGCGAATTCAAAATTAGGGTGGTGAAGCAAATCTTCTGGGTCAATGGCATGAGGTATGAATT
GCAAGAGATTTATGGCATTGGGAATTCAGTTGATAAGGACTTTGATGGAAATGATAATGGGAAGGAATGTGTCGTATGCCTTTCTGAACC
TCGAGACACTACTGXTACTTCCATGCCGACACATGTGCATGTGCAGTGGATGTGCACAAGTTTTGAGGTTCCAAACAAATCGTTGTCCTA
TTTGTCgTCAGCCAGTTGAGCGATTCTTGGAGATTAAGGTCAGCGAAGCTGCTGAAGAGTAA(3')GAGTCGCGATAACCACCATTAATG
TATAAAAACAGGGGCGAAGCTAGAAGCCTGAATACAGGTCTCGCTGAACCTAGTAACTTTTGCTCTTACACTACACTCTACAGTTGAAAA
TTGTGGCTCCGCCTTGTATAAACATATTCCTTTTTTCCTCAGTATCCAGTGACTGAAAAATGATGGAGTTTCCATCAAGTAAATGCGGGG
AAAGACCAATACACGGAGTTAAATAATGTATAGCAATACCAGATTTTTCATTATATGTATTAACACAGTCTGAAATGGTTACCACAAGGA
GGTAGATGGCAATTTGCTGATTTGAACTGTACTTAATTAAACAAGACAACAAATTACCAGAATTTGTTCTGTTTTATGGAGTACTGAATA
AAATATTTGTGCATATTAAACGAATTTTTAAACTTAAAAAAAAAAAAAAAAAAACTCGAGACTAGTTCTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan