ESTScan Details for Unigene SGN-U333165

Score 
435
Direction 
Forward
Predicted Peptide Sequence 
MAKIVSVLLLALLVISMLANTVMAANGKHHHYAKKYGPGSLKPCNVYHNVRGGVARHSTTSHACSSAKNVATSVCXVPPGTYGNKAVCPC
YNNWKTKEGGPKCP
Predicted Coding Sequence 
ATGGCCAAGATTGTTTCAGTTCTCCTTTTGGCCCTTCTTGTCATTTCCATGCTTGCTAACACTGTTATGGCTGCAAATGGCAAACACCAC
CACTATGCTAAGAAGTATGGACCAGGAAGCTTGAAGCCCTGCAATGTCTACCACAATGTACGAGGAGGTGTAGCAAGACACAGTACCACA
AGCCATGCATGTTCTTCTGCCAAAAATGTTGCAACAAGTGTTTGTGXTGTTCCACCTGGTACCTATGGAAACAAGGCTGTTTGTCCTTGT
TACAATAACTGGAAGACCAAGGAAGGAGGACCTAAATGCCCTTAA
Edits in Original Sequence 
TTTACTTCTATACTCTCATTTTCACCAAGAAAATCAAGC(5')ATGGCCAAGATTGTTTCAGTTCTCCTTTTGGCCCTTCTTGTCATTTC
CATGCTTGCTAACACTGTTATGGCTGCAAATGGCAAACACCACCACTATGCTAAGAAGTATGGACCAGGAAGCTTGAAGCCCTcGCAATG
TCTACCACAATGTACGAGGAGGTGTAGCAAGACACAGTACCACAAGCCATGCATGTTCTTCTGCCAAAAATGTTGCAACAAGTGTTTGTG
XTGTTCCACCTGGTACCTATGGAAACAAGGCTGTTTGTCCTTGTTACAATAACTGGAAGACCAAGGAAGGAGGACCTAAATGCCCTTAA
(3')TTTACTTTCTGTTTTCATCTAATATGTCTACCTAATCTTCTTGTTTTTTCTCCTATTGCACTTTTATCTAACCCAAGTGGTTATATA
TGTAATATGACCATATTTCCAGAGTTTAAATGGAACAAAAATATCACTCCCACTCTTGCTAGAAAGTTTAATCTTCCTTTGGACCAAACA
AATTTCCATCTTTCCTCATTAAAAAAAAAAAAAAAAAAAACTCGAGTTTATTTTTTATTTTGCATTGAGATAAGAAAATGTTGATCACAC
AAAATTTTATCAATTACTATTCTTCATCTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan