ESTScan Details for Unigene SGN-U333245

Score 
198
Direction 
Forward
Predicted Peptide Sequence 
ELQCDASAYNSLHAFHIGWPCLSFDVLRDSLGLERTEFPHSVYCVAGSQAEKSSWNSIGIFKLSKISGTRRDLVPDNTGDDSDMDGDSSD
SDEEXGSWIGDTCITVTQGVSEGCVNRIRAMTQKPDIVASWGDTGHVQVWDISSHINALAESESDLSHGASAVSSQAPLFKFGGHKDERY
AIHWSPRVPGKLVSGDCKNCIHLWEPTSGATWNVGAKSYIGHTASVEDPQWSPTEHTAFASCSIDRNIIIWDTRMVNPLA
Predicted Coding Sequence 
AAXGAGCTTCAGTGTGATGCTTCTGCTTATAATTCTCTTCATGCCTTCCACATTGGTTGGCCTTGCTTGAGTTTTGATGTGTTGCGCGAC
TCTCTCGGCTTAGAGCGGACTGAATTTCCACATTCTGTATACTGTGTAGCAGGATCACAGGCAGAGAAAAGTTCTTGGAACTCCATTGGT
ATATTTAAGTTGTCTAAAATATCTGGGACAAGGCGGGACTTGGTGCCAGACAACACAGGTGATGACTCTGACATGGACGGTGACAGTAGT
GACAGTGATGAAGAAXTAGGAAGCTGGATCGGGGACACCTGTATTACAGTTACGCAAGGTGTTTCTGAAGGATGTGTTAATCGTATACGT
GCTATGACACAAAAACCCGATATAGTTGCTTCTTGGGGTGATACTGGTCATGTTCAGGTTTGGGATATTAGCTCTCATATAAATGCTTTG
GCAGAATCCGAGAGTGATCTTAGCCATGGGGCTTCTGCAGTCTCTAGTCAAGCACCCTTATTTAAGTTTGGTGGACATAAAGATGAACGC
TATGCTATACACTGGAGTCCTCGTGTTCCCGGGAAGCTTGTTTCAGGTGACTGCAAGAATTGTATCCATTTGTGGGAGCCAACATCTGGT
GCCACATGGAATGTTGGTGCTAAATCTTACATTGGACACACTGCAAGTGTTGAGGATCCTCAGTGGAGCCCTACAGAACATACCGCATTC
GCTTCTTGCTCCATTGATAGAAATATTATCATATGGGACACCCGTATGGTCAACCCTCTTGCX
Edits in Original Sequence 
(5')AAXGAGCTTCAGTGTGATGCTTCTGCTTATAATTCTCTTCATGCCTTCCACATTGGTTGGCCTTGCTTGAGTTTTGATGTGTTGCG
CGACTCTCTCGGCTTAGAGCGGACTGAATTTCCACATTCTGTATACTGTGTAGCAGGATCACAGGCAGAGAAAAGTTCTTGGAACTCCAT
TGGTATATTTAAGTTGTCTAAAATATCTGGGACAAGGCGGGACTTGGTGCCAGACAACACAGGTGATGACTCTGACATGGACGGTGACAG
TAGTGACAGTGATGAAGAAXTAGGAAGCTGGATCGGGGACACCTGTATTACAGTTACGCAAGGTGTTTCaTGAAGGATGTGTTAATCGTA
TACGTGCTATGACACAAAAACCCGATATAGTTGCTTCTTGGGGTGATACTGGTCATGTTCAGGTTTGGGATATTAGCTCTCATATAAATG
CTTTGGCAGAATCCGAGAGTGATCTTAGCCATGGGGCTTCTGCAGTCTCTAGTCAAGCACCCTTATTTAAGTTTGGTGGACATAAAGATG
AACGCTATGCTATACACTGGAGTCCTCGTGTTCCCGGGAAGCTTGTTTCAGGTGACTGCAAGAATTGTATCCATTTGTGGGAGCCAACAT
CTGGTGCCACATGGAATGTTGGTGCTAAATCTTACATTGGACACACTGCAAGTGTTGAGGATCCTCAGTGGAGCCCTACAGAACATACCG
CATTCGCTTCTTGCTCCATTGATAGAAATATTATCATATGGGACACCCGTATGGTCAACCCTCTTGCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan