ESTScan Details for Unigene SGN-U333282

Score 
-3
Direction 
Forward
Predicted Peptide Sequence 
MXFPGSDYXVFDVVGGGHENKDVLHVRHANGNVLVFGMKEFVIVTGLKCKGNVKDLSYPNSTPSRLLQKYFSNCLNGYNQESIDTAALQW
VIGRPHRNLWKWQYYTSSILSCYAILVRPLYDRRISNGR
Predicted Coding Sequence 
ATGTAATTTCCAGGTTCAGATTACTAAGTGTTTGATGTTGTTGGAGGTGGACATGAAAATAAAGATGTACTACATGTCCGTCATGCTAAT
GGGAATGTATTGGTGTTTGGTATGAAGGAATTTGTCATTGTAACTGGCCTTAAATGCAAAGGAAATGTTAAGGATTTATCATATCCTAAT
TCCACTCCGAGCCGATTATTACAAAAATATTTCTCTAATTGTCTTAACGGGTATAACCAAGAGTCGATTGATACAGCXGCTTTGCAATGG
GTAATTGGGAGACCACACAGGAATCTGTGGAAATGGCAATACTATACTTCATCAATACTTTCATGTTATGCCATCTTGGTGAGACCTTTA
TACGATAGAAGAATTTCTAATGGTCGX
Edits in Original Sequence 
TAAACAGGGCATGAATTATGTTATTAAAAAAATACCAGCACGTCCATTGAGGTTTGGAGCGACTTTTGATTTTGTGAATAAAATCAAATT
GTCAATAAAGGATGAAGGCGTTGCAATTTTCAAGAAAACAATTTTTGGACCATATTTGGAAATTCCAAA
(5')ATGTAATTTCCAGGTTC
AGATTACTAAGTGTTTGATGTTGTTGGAGGTGcGACATGAAAATAAAGATGTACTACATGTCCGTCATGCTAATGGGAATGTATTGGTGT
TTGGTATGAAGGAATTTGTCATTGTAACTGGCCTTAAATGCAAAGGAAATGTTAAGGATTTATCATATCCTAATTCCACTCCGAGCCGAT
TATTACAAAAATATTTCTCTAATTGTCTTAACGGGTATAACCAAGAGTCGATTGATACAGCXGCTTTGCAATGGGTAATTGGGAGACCAC
ACAGGAATCTGTGGAAATGGCAATACTATACTTCATCAATACTTTCATGTTATGCCATCTTGGTGAGACCTTTATACGtATAGAAGAATT
TCTAATGGTCGX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan