ESTScan Details for Unigene SGN-U333389

Score 
539
Direction 
Forward
Predicted Peptide Sequence 
EPPVAKFSHYAAAAAALPLLPRLLSIGALRSPYPASSSSLPEKXTDDDRPQSQYNRAPARSIIGGNRRFNISSAPYQRMYVDMEVEIHNL
EQDAYGAILRAFKAQSDALTWEKESLITELRKELRVSDDEHRDLLTKVNADNRIHSIREWRKTNGNQPIHDQLPSPTVSGSRKRAKSQSV
IMPLGAPLESLHHQTIAANTQPTTPGAKWGAAPGNGGFRSRPGQQVFSSRPVHYQQAGPGFSSVLRSGELA
Predicted Coding Sequence 
GAACCTCCXGTCGCGAAATTTTCTCACTACGCCGCTGCCGCTGCCGCCCTGCCGTTGCTGCCGAGATTGCTTTCCATCGGTGCTCTTCGC
TCACCTTATCCGGCTAGTTCTTCTTCTTTACCAGAAAAGGXTACTGATGATGATCGGCCTCAATCACAATATAATCGAGCCCCTGCAAGA
AGTATTATAGGTGGAAACAGACGGTTTAATATAAGTTCAGCCCCATACCAAAGGATGTATGTTGATATGGAAGTCGAAATTCACAACCTT
GAGCAGGATGCATATGGTGCAATCCTTCGAGCGTTCAAAGCACAGTCTGATGCTCTTACATGGGAAAAGGAAAGCTTGATAACAGAACTC
AGGAAAGAGCTGAGAGTGTCAGATGATGAGCACAGAGACCTACTGACCAAGGTGAATGCCGATAACCGTATTCATAGTATCAGGGAGTGG
AGAAAGACCAATGGAAACCAACCTATTCATGATCAACTCCCCAGTCCAACAGTTTCTGGGTCAAGAAAGAGGGCAAAGTCACAATCTGTG
ATAATGCCACTTGGTGCCCCGTTGGAGTCCTTGCACCATCAGACAATTGCAGCAAACACGCAACCTACTACTCCAGGTGCAAAATGGGGA
GCAGCACCAGGAAATGGAGGATTTAGGTCTAGACCTGGCCAGCAAGTGTTCTCTTCAAGGCCTGTTCATTATCAGCAGGCTGGTCCTGGT
TTCTCAAGTGTTCTTCGTTCTGGTGAACTTGCT
Edits in Original Sequence 
(5')GAACCTCCXGTCGCGAAATTTTCTCACTACGCCGCTGCCGCTGCCGCCCTGCCGTTGCTGCCGAGATTGCTTTCCATCGGTGCTCT
TCGCTCACCTTATCCGGCTAGTTCTTCTTCTTTACCAGAAAAGGXTACTGATGATGATCGGCCTCAATCACAATATAATCGAGCCCCTGC
AAGAAGTATTATAGGTGGAAACAGACGGTTTAATATAAGTTCAGCCCCATACCAAAGGATGTATGTTGATATGGAAGTCGAAATTCACAA
CCTTGAGCAGGATGCATATGGTGCAATCCTTCGAGCGTTCAAAGCACAGTCTGATGCTCTTACATGGGAAAAGGAAAGCTTGATAACAGA
ACTCAGGAAAGAGCTGAGAGTGTCAGATGATGAGCACAGAGACCTACTGACCAAGGTGAATGCCGATAACCGTATTCATAGTATCAGGGA
GTGGAGAAAGACCAATGGAAACCAACCTATTCATGATCAACTCCCCAGTCCAACAGTTTCTGGGTCAAGAAAGAGGGCAAAGTCACAATC
TGTGATAATGCCACTTGGTGCCCCGTTGGAGTCCTTGCACCATCAGACAATTGCAGCAAACACGCAACCTACTACTCCAGGTGCAAAATG
GGGAGCAGCACCAGGAAATGGAGGATTTAGGTCTAGACCTGGCCAGCAAGTGTTCTCTTCAAGGCCTGTTCATTATCAGCAGGCTGGTCC
TGGTTTCTCAAGTGTTCTTCGTTCTGGTGAACTTGCT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan