ESTScan Details for Unigene SGN-U333457

Score 
-327
Direction 
Reverse
Predicted Peptide Sequence 
GLRPDRRFWPLPLESTSLNSGXLFQNGPTTQPYLGLFFGFIRDFADFPYWLKNELINKNLTRILQNINAYNLPFAIQAAQLLGRAIGAGF
FVITPAGERGMCSKAIKLGNARVFPVTTVVKRRPVNCNTTHYRGNWVPGPPW
Predicted Coding Sequence 
XTGGGCCTTCGCCCTGATAGACGTTTTTGGCCTTTGCCGTTGGAGTCCACTTCTTTAAATAGTGGAXTTCTGTTCCAAAACGGACCAACC
ACTCAACCTTATCTCGGTCTATTCTTTGGATTTATAAGGGATTTTGCCGATTTCCCTTATTGGTTAAAAAATGAGCTGATTAACAAAAAT
TTAACGCGAATTTTACAAAATATTAACGCTTACAATTTGCCATTCGCCATTCAGGCTGCGCAATTGTTGGGAAGGGCGATCGGTGCGGGC
TTCTTCGTTATTACGCCAGCTGGCGAAAGGGGGATGTGCTCCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACXGTT
GTAAAACGCCGGCCAGTGAATTGTAATACGACTCACTATAGGGGGAATTGGGTCCCGGGCCCCCCCTGG
Edits in Original Sequence 
(5')XTGGGCCTTCGCCCTGATAGACGTTTTTGGCCTTTGCCGTTGGAGTCCACgTTCTTTAAATAGTGGAXTTCTGTTCCAAAACGGAC
CAACCACTCAACCTTATCTCGGTCTATTCTTTGGATTTATAAGGGATTTTGCCGATTTCgCCTTATTGGTTAAAAAATGAGCTGAtTTAA
CAAAAATTTAACGCGAATTTTaACAAAATATTAACGCTTACAATTTGCCATTCGCCATTCAGGCTGCGCAATTGTTGGGAAGGGCGATCG
GTGCGGGCTTCTTCGTTATTACGCCAGCTGGCGAAAGGGGGATGTGCTCCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCA
CGACXGTTGTAAAACGCCGGCCAGTGAATTGTAATACGACTCACTATAGGGGGAATTGGGTCCCGGGCCCCCCCTGG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan