ESTScan Details for Unigene SGN-U333520

Score 
20
Direction 
Forward
Predicted Peptide Sequence 
APVVGGALDLGDPPGLRIWSFXGILKIDIEXLMEWRIPTTITPHTKSEALVSVLKKEDSACFPTFFSGYRPQFYMRTTDVTGKVTSITTD
KGDEFKMVMPGDRVNLVVELIMPVAREXTDDILHRVMIKNG
Predicted Coding Sequence 
XCTGCTCCCGTAGTAGGTGGAGCCCTAGACCTAGGGGATCCCCCXGGGCTGCGCATATGGTCNTTTANAGGTATTCTTAAGATTGATATT
GAGANATTAATGGAGTGGCGTATTCCAACAACAATCACTCCTCACACCAAGTCAGAAGCTCTTGTGTCTGTTCTGAAAAAGGAGGACAGC
GCGTGCTTTCCCACATTCTTTTCGGGGTATAGGCCTCAGTTTTACATGAGGACCACCGATGTAACTGGGAAGGTTACTTCCATTACCACT
GACAAAGGCGACGAATTTAAGATGGTCATGCCTGGTGATCGTGTGAACTTGGTGGTTGAGCTCATTATGCCTGTCGCTCGTGAAXCAACG
GATGATATCCTCCATCGTGTAATGATCAAAAACGGTTAA
Edits in Original Sequence 
(5')XCTGCTCCCGTAGTAGGTGGAGCCCTAGACCTAGGGGATCCCCCXGGGCTGCGCATATGGTCNTTTANAGGTATTCTTAAGATTGA
TATTGAGANATTAATGGtAGTGGCGTATTCCAACAACAATCACTCCTCACACCAAGTCAGAAGCTCTTGTGTCTGTTCTGAAAAAGGAGG
ACAGCGtCGTGCTTTCCCACATTCTTTTCGGGGTATAGGCCTCAGTTTTACATGAGGACCACCGATGTAACTGGGAAGGTTACTTCCATT
ACCACTGACAAAGGCGACGAATTTAAGATGGTCATGCCTGGTGATCGTGTGAACTTGGTGGTTGAGCTCATTATGCCTGTCGCTCGTGAA
XCAACGGATGATATCCTCCATCGTGTAATGATCAAAAACGGTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan