ESTScan Details for Unigene SGN-U333576

Score 
60
Direction 
Forward
Predicted Peptide Sequence 
MLKLGLSIDEESGNADADMPALEDPEADAEGDKMEDVEKFINVMIVTWVPLLLLYDLVFAXIPSEQYVRVLMPTFTMAIEWEDIILFFAL
TFVVDTTDYLAQKKEKKISRGGRDPKCPIVRRMTIHWPSFYNVKTGKTLALPILIASLHMLLSPAGVIANRPAPMTFPTIAQPEWRMANC
KRKYYVNLTVKFLIKQLNYEPKAEIGKHPYKREEWTAIGLNVCPXWEQESTFKERGLQPLRAKKPSFKANGPTSLX
Predicted Coding Sequence 
ATGTTGAAACTCGGTTTGAGCATTGATGAGGAAAGCGGAAATGCTGATGCTGACATGCCAGCATTGGAGGATCCTGAAGCTGATGCTGAG
GGCGACAAGATGGAGGATGTGGAGAAGTTCATTAATGTTATGATAGTTACATGGGTTCCTTTACTACTACTTTATGACCTAGTCTTTGCT
XTTATCCCATCAGAACAATATGTGAGGGTTCTAATGCCAACTTTTACAATGGCAATTGAATGGGAGGATATAATTCTATTTTTTGCATTG
ACATTCGTGGTTGATACAACTGATTATCTTGCCCAAAAAAAAGAAAAAAAAATCTCGAGGGGGGGCCGGGATCCCAAATGCCCTATTGTG
AGGCGTATGACAATTCACTGGCCGTCGTTTTACAACGTCAAGACTGGAAAAACCCTGGCGTTACCCATCTTAATCGCATCGCTTCACATG
CTCCTTTCACCAGCTGGCGTAATAGCAAATAGGCCCGCACCGATGACCTTCCCAACAATTGCACAACCTGAATGGCGAATGGCAAATTGT
AAGCGAAAATATTATGTTAATTTAACXGTTAAATTTTTGATAAAGCAGCTAAATTATGAACCCAAGGCCGAAATTGGCAAACACCCTTAT
AAAAGAGAAGAATGGACCGCGATTGGGCTGAATGTTTGTCCCXGTTGGGAACAGGAATCCACTTTTAAAGAACGTGGACTCCAACCTCTA
AGGGCCAAGAAACCTTCTTTTAAGGCCAATGGGCCCACTTCCTTGAXX
Edits in Original Sequence 
GGCCAAACACCTTTGGCAACAGAATTCACAGGATGTTGAAACTCGGTTTGAGCATTGATGAGGAAAGCGGAAATGCTGATGCTGACATGC
CAGCATTGGAGGATCCTGAAGCTGATGCTGAGGGCGACAAGATGGAGGATGTGGATGAAGTTC
(5')ATGTTGAAACTCGGTTTGAGCAT
TGATGAGGAAAGCGGAAATGCTGATGCTGACATGCCAGCATTGGAGGATCCTGAAGCTGATGCTGAGGGCGACAAGATGGAGGATGTGGA
tGAAGTTCATTAATGTTATGATAGTTACATGGGTTCCTTTACTACTACTTTATGACCTAGTCTTTGCTXTTATCCCATCAGAACAATATG
TGAGGGTTCTAATGCCgAACTTTTACAATGGCAATTGAATGGGAGGATATAATTCTATTTTTTGCATTGACATTCGTGGTTGATACAACT
GATTATCTTGCCCAAAAAAAAGAAAAAAAAATCTCGAGGGGGGGCCGGGATCCCAAtATGCCCTATTGTGAGGCGTATGACAATTCACTG
GCCGTCGTTTTACAACGTCAAGACTGGAAAAACCCTGGCGTTACCCATCTTAATCGCATCGCTTCACATGCTCCTTTCACCAGCTGGCGT
AATAGCAAATAGGCCCGCACCGATcGACCTTCCCAACAATTGCACAACCTGAATGGCGAATGGCAAATTGTAAGCGAAAATATTATGTTA
ATTTAACXGTTAAATTTTTGATAAAGCAGCTAAATTATGAACCCAtAGGCCGAAATTGGCAAACACCCTTATAAAAGAGAAGAATGGACC
GCGATTGGGCTGAATGTTTGTCCCXGTTGGGAACAGGAATCCACTTTTAAAGAACGTGGACTCCAACCTCTAAGGGCCgAAGAAACCTTC
TTTTAAGGCCAATGGGCCCACTTCCTTGAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan