ESTScan Details for Unigene SGN-U333602

Score 
547
Direction 
Forward
Predicted Peptide Sequence 
MNTEYDYLFKLLLIGDSGVGKSCLLLRFADDTYQESYISTIGVDFKIRTVEQDGKTIKLQIAVIYFDTVXWDTAGQERFRTITSSYYRGA
HGIIVSSDLNFFNXNIRTIVACRVKLPLSVPVTFYILFMASMVVVYDVTDQESFNNVKQWLSEIDRYATPNVNKILVGNKSDLVASRVVS
YETAKAFADEIGIPFLETSAKDASNVEESFMAMTAAIKKSMANQPVPNAAQPPNVNIRGQPVAQNMAAARLEERPNLLAGSPLIHDMSTV
ISLINNNVYLVALSCKIPTAKNXLYFLEKKYLFLLKWTNCETNDLNINCCPSPFGLFLLKIISYVLPKKNKIKKTHHTKAPQKQQAPKGR
ANIYSPLKXEFMHITSVKKTPKXXLFFSPPYPANSPFTYYICITLPTCIYRMSIFSPHTIIADIPPPAP
Predicted Coding Sequence 
ATGAATACAGAATATGACTACCTGTTCAAACTTCTGCTTATTGGTGATTCTGGTGTTGGAAAGTCATGTCTCCTTTTGAGGTTTGCTGAT
GACACATATCAGGAGAGCTACATAAGCACAATTGGAGTTGATTTTAAAATCAGGACAGTGGAGCAAGATGGAAAGACCATTAAGCTTCAA
ATTGCTGTTATCTATTTTGACACTGTTTAGTGGGATACTGCTGGACAAGAGCGTTTTAGGACTATCACTAGCAGCTACTATCGTGGAGCC
CATGGCATAATAGTGAGTAGTGACCTTAATTTTTTTAACAXCAATATAAGAACAATTGTTGCCTGTAGAGTTAAATTACCGCTTTCAGTA
CCTGTTACATTCTACATTCTTTTTATGGCCTCTATGGTGGTTGTTTATGATGTGACGGATCAGGAGAGCTTCAATAATGTGAAACAATGG
CTGAGTGAAATTGACCGTTATGCTACCCCAAATGTTAACAAAATTCTTGTTGGGAACAAGTCTGACCTTGTTGCCAGTAGAGTTGTGTCG
TATGAAACAGCTAAGGCCTTTGCTGATGAAATTGGTATTCCATTCTTGGAGACCAGTGCGAAAGATGCTAGTAACGTAGAAGAGTCTTTC
ATGGCTATGACTGCTGCTATCAAGAAAAGTATGGCAAACCAACCGGTCCCAAATGCTGCCCAGCCTCCAAATGTAAATATTCGTGGACAG
CCCGTTGCTCAAAATATGGCTGCTGCTCGTCTTGAAGAACGTCCGAATTTGCTTGCTGGCTCCCCTCTCATCCATGACATGTCTACGGTA
ATCTCACTAATCAACAACAATGTTTACCTTGTAGCCTTGTCCTGCAAAATCCCTACTGCTAAAAATXATCTTTATTTTCTTGAGAAGAAA
TATTTGTTTTTATTGAAATGGACCAATTGTGAAACAAATGATCTTAACATTAATTGTTGCCCTTCACCCTTTGGCCTGTTTTTGCTTAAA
ATAATTTCTTATGTTCTCCCGAAAAAAAATAAAATAAAAAAAACTCACCACACTAAGGCTCCCCAAAAACAACAGGCCCCTAAAGGCCGC
GCCAATATTTATAGCCCCCTCAAAGXGGAGTTTATGCACATAACCTCCGTGAAAAAAACTCCAAAAANCNNCCTCTTCTTTAGCCCTCCA
TATCCTGCTAACTCCCCCTTCACATATTATATCTGTATTACACTTCCAACTTGCATCTATAGAATGTCAATTTTCTCCCCTCATACTATC
ATTGCTGACATTCCACCACCTGCGCCX
Edits in Original Sequence 
ATCGGCCGAATTGGTTTTTTGCATCTGACCTCTGCCGCGAAGGATCAATATCCGCCGCTAAATTCCTCATATTCCGGCGAATTTCGTGTG
CTTGTAATCGCCATGAATACAGAATATGACTACCTGTTCAAACTTCTGCTTATTGGTGATTC
(5')ATGAATACAGAATATGACTACCTG
TTCAAACTTCTGCTTATTGGTGATTCTGGTGTTGGAAAGTCATGTCTCCTTTTGAGGTTTGCTGATGACACATATCAGGAGAGCTACATA
AGCACAATTGGAGTTGATTTTAAAATCAGGACAGTGGAGCAAGATGGAAAGACCATTAAGCTTCAAATTGCTGTTATCTATTTTGACACT
GTTTAGTGGGATACTGCTGGACAAGAGCGTTTTAGGACTATCACTAGCAGCTACTATCGTGGAGCCCATGGCATAATAGTGAGTAGTGAC
CTTAATTTTTTTAACAXCAATATAAGAACAATTaGTTGCCTGTAGAGTTAAATTACCGCTTTCAGTACCTGTTACATTCTACATTCTTTT
TATGGCCTCTATGGTaGGTTGTTTATGATGTGACGGATCAGGAGAGCTTCAATAATGTGAAACAATGGCTGAGTGAAATTGACCGTTATG
CTACCCCAAATGTTAACAAAATTCTTGTTGGGAACAAGTCTGACCTTGTTGCCAGTAGAGTTGTGTCGTATGAAACAGCTAAGGCCTTTG
CTGATGAAATTGGTATTCCATTCTTGGAGACCAGTGCGAAAGATGCTAGTAACGTAGAAGAGTCTTTCATGGCTATGACTGCTGCTATCA
AGAAAAGTATGGCAAACCAACCGGTCCCAAATGCTGCCCAGCCTCCAAATGTAAATATTCGTGGACAGCCCGTTGCTCAAAATAgTGGCT
GCTGCTCGTCTTGAgAGAACGTCCGAATTTGCTTGCTGGCTCCCCTCTCATCCATGACATGTCTACGGTAATCTCACTAATCAACAACAA
TGTTTAcCCTTGTAGCCTTGTCCTGCAAAATCCCTACTGCTAAAAATXATCTTTATTTTCTTGAGAAGAAATATTTGTTTTTATTGAAAT
GGACCAATTGTGAAACAAATGATCTTAACATTAATTGTTGCCCTTCACCCTTTGGCCTGTTTTTGCTTAAAATAATTTCTTATGTTCTCC
CGAAAAAAAATAAAATAAAAAAAACTCACCACACTAAGGCTCCCCAAAAACAACAGcGCCCCTAAAGGCCGCGCCAATATTTATAGCCCC
CTCAAAGXGGAGTTTATGCACATAACCTCCGTGAAAAAAACTCCAAAAANCNNCCTCTTCTTTAGCCCTCCtATATCCTGCTAACTCCCC
CTTCACATATTATATCTGTATTACACTTCCAACTTGCATCTATAGAATGTCAATTTTCTCCCCTCATACTATCATTGCTGACATTCCACC
ACCTGCGCCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan