ESTScan Details for Unigene SGN-U333620

Score 
-41
Direction 
Forward
Predicted Peptide Sequence 
GESNTSPSWVGQKGLGVTPHHNSLRGGEHPCYVETTLALPIHEKKIRKLNQTLELGLSLLMLRGGGQQVNIIWKNPLPEGKRKFPPATRE
ETPPEATEIKTPPAQFLQPGGSPNSKTAPXPGGTPAFVPFREGXFPAWRNHGHNCFLGEIVIPSQFHTKYEPET
Predicted Coding Sequence 
GGGGAGTCTAACACCTCCCCCAGTTGGGTGGGACAAAAAGGGCTGGGAGTTACCCCACACCACAACAGTCTGCGAGGGGGTGAACACCCT
TGTTATGTTGAAACAACCCTGGCACTTCCCATCCATGAAAAAAAAATTAGGAAATTGAACCAAACGCTTGAGCTTGGGCTTTCTCTTCTC
ATGCTCAGGGGGGGGGGTCAACAAGTCAACATCATTTGGAAAAACCCTCTTCCCGAGGGTAAAAGGAAATTCCCGCCGGCAACGAGGGAG
GAAACCCCTCCXGAGGCAACTGAAATAAAAACCCCTCCGGCCCAATTCCTGCAGCCCGGGGGATCCCCTAATTCTAAAACGGCCCCCXCC
CCCGGGGGAACTCCCGCTTTTGTTCCCTTTAGGGAGGGGTAATTTCCAGCTTGGCGGAATCATGGGCATAACTGTTTCCTGGGGGAAATT
GTTATCCCCTCCCAATTCCACACAAAATACGAGCCGGAAACATAA
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCTTTGAAATGAAACCCCATTTAATTGAAAAACATAACATAACCTG
GCATTTGGAAATCCCAAATCCTTTGTTCTAAAACAAAAACAGGATTACCCCCAAACTTAATTTGTCCCCCCTATTAACTTTATCACTTCT
GGTCTTCTCTAATCTCCCTTTCTCCTGAAAAAAAAACCCCCGGGGAGTCTAACACCTCCCCCAGTTGGGTGGGA
(5')GGGGAGTCTAAC
ACCTCCCCCAGTTGGGTGGGACAAAAAGGGCTGGGAGTTACCCCACACCACAACAGTCTGCGAGGGGGTGAACACCCTTGTTATGTTGAA
ACAACCCTGGCACTTCCCATCCATGAAAAAAAAATTAGGAAATTGAACCAAACGCTTGAGCTTGGGCTTTCTCTTCTCATGCTCAGGGGG
GGGGGTCAACAAGTCAACATCATTTGGAAAAACCCTCTTCCCGAGGGTAAAAGGAAATTCCCGCCGGCAACGAGGGAGGAAACCCCTCCX
GAGGCAACTGAAATAAAAACCCCTCCGGCCCAATTCCTGCAGCCCGGGGGATCCCCTAATTCTAAAACGGCCCCCXCCCCCGGGGGAACT
CCCGCTTTTGTTCCCTTTAGGGAGGGGTAATTTCCAGCTTGGCGGAATCATGGGCATAACTGTTTCCTGGGGGAAATTGTTATCCCCTCC
CAATTCCACACAAAATACGAGCCGGAAACATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan