ESTScan Details for Unigene SGN-U333621

Score 
78
Direction 
Forward
Predicted Peptide Sequence 
MAFVNPKSVCSKTKTGXTPKLNLSPILTLSLLFFSNLPSPERTTLGESSTPPVGWHKTVWQIPHTTTVCEWLNTVXYVKATLALHIHEER
VRRLNQTLELVLSLLMLSWWVQQVNIIWKNHLREVNRKFRPAAREEPXSEAAEMKPRAEFLQPGGSTSSKAAATAVELQLLFPLVRVNFQ
LGVIMVIAVSCVKLLSLTIPPHIPPGSINVKPGVPNDELTHINCVALTARFPVRKPVLPTXINESAQTPGEKPVCQIEAPLPLSSPTLNS
LAASAPFGTARKTG
Predicted Coding Sequence 
ATGGCATTTGTAAATCCTAAATCCGTTTGTTCTAAAACAAAAACAGGAXTTACACCAAAACTTAATTTGTCACCCATATTAACTTTATCA
CTTCTGTTCTTCTCTAATCTCCCTTCTCCTGAAAGAACAACCCTCGGTGAGTCTAGCACTCCACCAGTTGGCTGGCACAAGACGGTCTGG
CAGATACCGCACACCACAACAGTCTGCGAGTGGCTGAACACCGTTGXTTATGTTAAAGCAACCCTGGCACTTCACATCCATGAAGAAAGA
GTTAGGAGATTGAACCAAACGCTTGAGCTTGTGCTTTCTCTTCTCATGCTCAGCTGGTGGGTTCAACAAGTCAACATCATTTGGAAGAAC
CATCTTCGCGAGGTTAACAGGAAATTCCGGCCGGCAGCGAGGGAGGAACCGXCGTCGGAGGCAGCTGAGATGAAGCCTCGTGCCGAATTC
CTGCAGCCCGGGGGATCCACTAGTTCTAAAGCGGCCGCCACCGCGGTGGAGCTCCAGCTTTTGTTCCCTTTAGTGAGGGTTAATTTCCAG
CTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCCTCACAATTCCACCCCACATACCACCCGGAAGCATAAATGTA
AAGCCTGGGGTGCCTAATGATGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCAGGAAACCTGTCTTGCCCACC
TGAATTAATGAATCCGCCCAAACCCCCGGGGAAAAGCCCGTTTGCCAAATTGAGGCGCCTCTTCCGCTTTCCTCCCCTACATTGAACTCC
CTTGCXGCCTCGGCTCCTTTCGGAACTGCGAGGAAAACCGGTTAA
Edits in Original Sequence 
TTTTTTTTTTTTTTTAATTCAAATCCAGAGTGAATTGAAACCCCCTTTAAAGGACAAACATAACATAACATGGCATTTGTAAATCCTAAA
TCCGTTTGTTC
(5')ATGGCATTTGTAAATCCTAAATCCGTTTGTTCTAAAACAAAAACAGGAXTTACACCAAAACTTAATTTGTCACCC
ATATTAACTTTATCACTTCTGTTCTTCTCTAATCTCCCtTTCTCCTGAAAGAACAACCCTCGGTGAGTCTAGCACgTCCACCAGTTGGCT
GGCACAAGACGGTCTGGCAGATACCGCACACCACAACAGTCTGCGAGTGGCTGAACACCGTTGXTTATGTTAAAGCAACCCTGGCACTTC
ACATCCATGAAGAAAGAGTTAGGAGATTGAACCAAACGCTTGAGCTTGTGCTTTCTCTTCTCATGCTCAGCTGGTGGGTTCAACAAGTCA
ACATCATTTGGAAGAACCATCTTCGCGAGGTTAACAGGAAATTCCGGCCGGCAGCGAGGGAGGAACCGXCGTCGGAGGCAGCTGAGATGA
AGCCTCGTGCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAAAGCGGCCGCCACCGCGGTGGAGCTCCAGCTTTTGTTCCCTTTAG
TGAGGGTTAATTTCCAGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCgCTCACAATTCCACCCCACATACCA
CCCGGAAGCATAAAgTGTAAAGCCTGGGGTGCCTAATGAgTGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCA
GGAAACCTGTCTTGCCCACCTGAATTAATGAATCCGCCCAAACCCCCGGGGAAAAGCCCGTTTGCCAAATTGAGGCGCCTCTTCCGCTTT
CCTCCCCTACATTGAACTCCCTTGCXGCCTCGGCTCCTTTCGGAACTGCGAGGAAAACCGGTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan