ESTScan Details for Unigene SGN-U333675

Score 
513
Direction 
Reverse
Predicted Peptide Sequence 
MSSSSVPPGPVPESAIETQYLDTKESHSSNNGLIQLQSKQMDPTKIKYPVKFXNIRQACVPKNLIVESSKRQRVLAGFGFHKEFLSKVDY
LLENKAFFGKADSEEGFESGAVALANLLEASSATVVGKEVFLLVSIDKNPDGNEGGKRQLITAPVNDGTLYYLQGTAGVKRWFKGAKKFV
ENTAPSFSIA
Predicted Coding Sequence 
ATGTCTTCCTCTAGTGTACCGCCTGGTCCAGTTCCTGAATCTGCTATTGAGACTCAATATTTGGACACCAAGGAATCCCATTCTTCCAAC
AATGGATTGATTCAGCTCCAGTCCAAGCAAATGGACCCAACAAAAATTAAGTACCCTGTCAAGTTTXACAATATAAGGCAAGCTTGTGTC
CCCAAGAATCTTATTGTCGAGTCCTCCAAAAGACAAAGAGTCCTCGCCGGGTTCGGCTTCCATAAAGAGTTCCTCTCTAAAGTGGACTAT
CTGCTAGAAAACAAAGCTTTCTTTGGTAAAGCTGATTCAGAGGAAGGTTTTGAATCTGGCGCAGTGGCACTTGCTAACCTGTTGGAGGCA
TCTAGCGCAACAGTGGTAGGAAAAGAAGTATTCCTACTTGTCAGTATTGACAAGAACCCAGATGGAAATGAAGGTGGAAAGCGCCAGTTG
ATCACAGCCCCAGTAAATGATGGCACACTTTACTATTTGCAAGGCACTGCTGGTGTCAAGAGATGGTTTAAGGGTGCTAAAAAGTTTGTG
GAAAATACTGCCCCTTCTTTCAGTATTGCTTAA
Edits in Original Sequence 
ATTTAAGTTTGTATGCACTTAGTTCTTC(5')ATGTCTTCCTCTAGTGTACCGCCTGGTCCAGTTCCTcGAATCTGCTATTGAGACTCAA
TATTTGGACACCAAGGAATCCCATTCTTCCAACAATGGATTGATTCAGCTCCAGTCCAAGCAAATGGACCCAACtAAAAATTAAGTACCC
TGTCAAGTTTXACAATATAAGGCAAGCTTGTGTCCCCAAGAATCTTATgTGTCGAGTCCTCCAAAAGACAAAGAGTCCTCGCCGGGTTCG
GCTTCCATAAAGAGTTCCTCTCTAAAGTGGACTATCTGCTAGAAAACAAAGCTTTCTTTGGTAAAGCTGATTCAGAGGAAGGTTTTGAAT
CTGGCGCAGTGGCACTTGCTAACCTGTTGGAGGCATCTAGCGCAACAGTGGTAGGAAAAGAAGTATTCCTACTTGTCAGTATTGACAAGA
ACtCCAGATGGAAATGAAGGTGGAAAGCGCCAGTTGATCACAGCCCCAGTAAATGATGGCACACTTTACTATTTGCAAGGCACTaGCTGG
TGTCAAGAGATGGTTTAAGGGTGCTAAAAAGTTTGTGGAAAATACTGCCCCTTCTTTCAGTATTGCTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan