ESTScan Details for Unigene SGN-U333720

Score 
100
Direction 
Forward
Predicted Peptide Sequence 
MDKSRVTLQGTYLPWVHHSFLHIQTFHLYQNNSNPCTLCNMWYIRGDKLTIFLGNGDILNRQYLDPNKGASFWLFWIKSSSQIKFPKEFK
ITTLIAWQQLGHWDLGAFFERGLSEPDYPSLDKLDHNRTFRQXGGAQNTLGQLRNCTAFGPIGTRDWPGHFLLGICGKEMSEEPNQT
Predicted Coding Sequence 
ATGGACAAGTCTAGAGTCACATTACAGGGGACATATTTGCCTTGGGTTCATCACTCTTTCCTTCACATACAAACTTTCCATCTTTACCAA
AATAATAGCAACCCTTGTACCCTGTGCAACATGTGGTACATCCGGGGGGATAAATTAACGATTTTTCTTGGGAACGGGGACATTTTGAAT
AGGCAATATTTGGATCCAAATAAAGGTGCAAGCTTTTGGCTTTTTTGGATAAAATCTTCTTCACAAATAAAATTTCCGAAGGAATTTAAA
ATTACAACCCTTATAGCCTGGCAACAATTGGGGCATTGGGATTTAGGGGCTTTCTTTGAACGGGGGTTATCCGAACCAGATTACCCATCT
TTAGACAAGCTGGATCACAATAGAACATTCAGACAANTGGGXGGAGCGCAAAATACTCTTGGACAGCTGAGGAATTGTACTGCCTTTGGG
CCAATTGGAACTAGGGACTGGCCCGGCCATTTTCTCTTGGGGATATGTGGAAAAGAAATGTCGGAAGAACCAAACCAAACX
Edits in Original Sequence 
AGGATGGGGAATAGGGATAATCTATTGGTCTTATTCAGATAATTAGTAATTACACATAACACACAACTTTGATGCCCACATTATAATGAT
TAGCATGGCATTATATAAGGGGGCATCCTTTTATTTCATACATTAATTACTTAATTTTGGGCAATCCAGAAGATGGACAAGTCTAGAGTC
ACATTACAGGGGACATATTTGCCTTGGGTTCATCACTCTTTCCTTCACATACAAACTTTCCATCTTTACCAAAATAATAGCAACCCTTGT
ACCCTGT
(5')ATGGACAAGTCTAGAGTCACATTACAGGGGACATATTTGCCTTGGGTTCATCACTCTTTCCTTCACATACAAACTTTCC
ATCTTTACCAAAATAATAGCAACCCTTGTACCCTGTGCAACATGTGGTACATCCGGGGGGATAAATTAACGATTTTTCTTGGGAACGGGG
ACATTTTGAATAGGCAATATTTGGATCaCAAATAAAGGTGCAAGCTTTTGGCTTTTTTGGATAAAATCTTCTTCACAAATAAAATTTCCG
AAGGAATTTAAAATTACAACCCTTATAGCCTGGCAACAATTGGGGCATTGGGATTTAGGGGCTTTCTTTGAACGGGGGTTATCCGAACCA
GATTACCCATCTTTAGACAAGCTGGATCACAATAGAACATTCAGACAANTGGGXGGAGCGCAAAATACTCTTGGACAGCTGAGGAATTGT
ACTGCCTTTGGGCCAATTGGAACTAGGGACTaGGCCCGGCCATTTTCTCTTGGGGATATGTGGAAAAGAAATGTCGGAAGAACCAAACCA
AACX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan