ESTScan Details for Unigene SGN-U333740

Score 
-167
Direction 
Reverse
Predicted Peptide Sequence 
RVSKPRLPPREVGTPCSTGKYKPPFARRKPRHNPKYLGPPRQASGLAPFPWKGFANTKGGKGFPPGFQAPPIKQRSLFGPKTAGLPNGGT
PPPLYQNGRWRVRWKVYINKPVLVTRKIRLPPITVSKPTHKAPQALHFILPARILCGIVKNNNFTQETAXDLDYAKLEINPPLKGTKAGA
PRLQVDTVDPKNSAPGVYQNL
Predicted Coding Sequence 
AGGGTGTCCAAGCCAAGGCTTCCTCCCAGGGAGGTTGGGACCCCTTGCAGCACAGGAAAATACAAACCCCCTTTCGCAAGGCGAAAGCCC
CGGCATAACCCGAAATACCTAGGGCCTCCCCGGCAGGCATCAGGATTAGCTCCATTTCCATGGAAGGGTTTTGCAAACACCAAGGGGGGG
AAGGGGTTTCCCCCGGGTTTCCAAGCCCCCCCCATTAAGCAAAGGAGTTTGTTTGGCCCAAAAACAGCGGGCCTTCCAAATGGCGGAACA
CCTCCCCCCCTTTACCAAAATGGCCGGTGGCGTGTCCGGTGGAAGGTCTATATAAACAAACCGGTTTTAGTAACCCGTAAAATCCGCCTA
CCCCCAATTACTGTGAGTAAGCCCACTCATAAGGCACCCCAGGCTTTACACTTTATACTTCCGGCTCGTATATTGTGTGGAATTGTGAAG
AATAACAATTTCACACAGGAAACAGCTXATGACCTTGATTACGCCAAGCTCGAAATTAACCCTCCXCTAAAGGGAACAAAAGCTGGAGCT
CCGCGCCTGCAGGTCGACACTGTGGATCCAAAGAATTCGGCCCCAGGTGTCTACCAAAATCTATAG
Edits in Original Sequence 
(5')AGGGTGTCCAAGCCAAGGCTTCCTCCCAGGGAGGTTGGGACCCCTTGCAGCACAGGAAAATACAAACCCCCTTTCGCAAGGCGAAA
GCCCCGGCATAACCCGAAATACCTAGGGCCTCCCCGGCAGGCATCAGGATTAGCTCCATTTCCATGGAAGGGTTTTGCAAACACCAAGGG
GGGGAAGGGGTTTCCCCCGGGTTTCCAAGCCCCCCCCATTAAGCAAAGGAGTTTGTTTGGCCCAAAAACAGCGGGCCTTCCAAATGGCGG
AACACCTCCCCCCCTTTACCAAAATGGCCGGTaGGCGTGTCCGGTGGAAGGTCTATATAAACAAACCGGTTTTAGTAACCCGTAAAATCC
GCCTACCCCCAATTACTGTGAGTAAGCCCACTCATAAGGCACCCCAGGCTTTACACTTTATACTTCCGGCTCGTATATTGTGTGGAATTG
TGAAcGAATAACAATTTCACACAGGAAACAGCTXATGACCTTGATTACGCCAAGCTCGAAATTAACCCTCCXCTAAAGGGAACAAAAGCT
GGAGCTCgCGCGCCTGCAGGTCGACACTaGTGGATCCAAAGAATTCGGCCCCAGGTGTCTACCAAAATCTATAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan