ESTScan Details for Unigene SGN-U333762

Score 
983
Direction 
Forward
Predicted Peptide Sequence 
MFGRAPKKSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDPEKFKELAQAYEVLSDPEKREIYDQYGEDALKEGMGGGGGGHD
PFDIFQSFFGGGGXSKKLSLSRNVLCSKCKGKGSKSGASMKCSGCQGSGMKVSIRQLGPSMIQQMQHPCNECKGTGEMISDKDRCPQCKG
EKVVQEKKVLEVHVEKGMQNGQKVTFPGEADEAPDTITGDIVFXLATKEHPKVKRKGDDLFVEHTLTLTEALCGFQFVLTPLDNRQLLIK
SQPGEICQPDSVLRYPRRRDAHVPRAVXGKVKWTFPFRVIFPSLNRKTVAETFGLGWPPNPKLAVFDFGIKTGGGTLFWPVVNFGXINLQ
ENPHPAPKGFLQKIDNALGGTQ
Predicted Coding Sequence 
ATGTTTGGAAGAGCACCGAAGAAGAGCGATAATACAAAGTATTATGAGATCTTAGGAGTTCCTAAGGCTGCTTCTCAGGAAGATCTCAAA
AAGGCTTATCGTAAAGCTGCTATCAAAAATCATCCTGATAAGGGAGGCGATCCTGAGAAGTTTAAAGAGCTTGCTCAAGCTTATGAGGTC
TTGAGTGACCCGGAGAAGCGTGAGATATATGATCAGTATGGAGAGGATGCTCTAAAGGAAGGAATGGGTGGTGGAGGTGGTGGACATGAC
CCATTTGATATATTTCAATCATTCTTCGGTGGTGGTGGAXCATCAAAGAAGCTTTCACTATCTCGCAATGTGTTGTGCTCAAAGTGCAAG
GGTAAAGGGTCCAAGTCAGGTGCTTCAATGAAATGTTCTGGCTGTCAAGGGTCTGGAATGAAAGTTTCTATCAGACAGCTCGGTCCATCC
ATGATCCAGCAGATGCAGCACCCTTGCAATGAGTGTAAGGGTACTGGTGAGATGATCAGTGACAAAGATAGGTGCCCTCAGTGTAAGGGT
GAGAAGGTTGTGCAGGAGAAGAAGGTGTTGGAAGTTCACGTGGAGAAGGGTATGCAGAATGGGCAGAAAGTAACATTTCCAGGCGAGGCA
GATGAAGCGCCAGATACCATCACTGGAGACATTGTTTTTGXTCTTGCCACAAAAGAACATCCTAAGGTCAAGCGAAAGGGAGATGATCTT
TTTGTTGAGCACACCTTGACCTTGACTGAGGCCCTATGTGGTTTCCAGTTTGTCTTGACTCCCCTAGACAACAGACAGCTGCTCATTAAG
TCCCAACCTGGCGAAATTTGTCAGCCTGATTCAGTTTTAAGGTATCCACGAAGAAGGGATGCCCATGTCCCAAGGGCCGTTXATGGAAAG
GTAAAATGGACTTTCCCTTTCCGTGTGATTTTCCCGAGTCTTAACCGCAAAACCGTGGCAGAAACCTTTGGGCTTGGCTGGCCTCCCAAC
CCCAAATTGGCAGTATTTGATTTTGGAATTAAAACAGGTGGGGGAACACTCTTTTGGCCCGTGGTGAACTTTGGAGAXATTAATTTGCAA
GAGAACCCCCACCCTGCCCCAAAAGGCTTTTTGCAAAAGATAGATAATGCCCTGGGGGGGACACAA
Edits in Original Sequence 
GCTTCATTTCCCTAAAAACACCGTCAAGAACCTCTCTTCTCCTCTTCTCGCCGCAACTTTCAATCGTTTCTATTGACTTAGTTCAACAGA
TCGAAAGATGTTTGGAAGAGCACCGAAGAAGAGCGATAATACAAAGTATTATGAGATCTTAGGAGTTCCT
(5')ATGTTTGGAAGAGCAC
CGAAGAAGAGCGATAATACAAAGTATTATGAGATCTTAGGAGTTCCTAAGGCTGCTTCTCAGGAAGATCTCAAAAAGGCTTATCGTAAAG
CTGCTATCAAAAATCATCCTGATAAGGGAGGCGATCCTGAGAAGTTTAAAGAGCTTGCTCAAGCTTATGAGGTCTTGAGTGACCCGGAGA
AGCGTGAGATATATGATCAGTATGGAGAGGATGCTCTAAAGGAAGGAATGGGTGGTGGAGGTGGTGGACATGACCCATTTGATATATTTC
AATCATTCTTCGGTGGTGGTGGAXCATCAAAGAAGCTTTCACTATCTCGCAATGTGTTGTGCTCAAAGTGCAAGGGTAAAGGGTCCAAGT
CAGGTGCTTCAATGAAATGTTCTGGCTGTCAAGGGTCTGGAATGAAAGTTTCTATCAGACAGCTCGGTCCATCCATGATCCAGCAGATGC
AGCACCCTTGCAATGAGTGTAAGGGTACTGGTGAGATGATCAGTGACAAAGATAGGTGCCCTCAGTGTAAGGGTGAGAAGGTTGTGCAGG
AGAAGAAGGTGTTGGAAGTTCACGTGGAGAAGGGTATGCAGAATGGGCAGAAAGTAACATTTCCAGGCGAGGCAGATGAAGCGCCAGATA
CCATCACTGGAGACATTGTTTTTGXTCTTGCCACAAAAGtAACATCCTAAGGTCAAGCGAAAGGGAGATGATCTTTTTGTTGAGCACACC
TTGACCTTGACTGAGGCCCTATGTGGTTTCCAGTTTGTCTTGACTCCCCTAGACAACAGACAGCTGCTCATTAAGTCCCAACCTGGCGAA
ATTTGTCAGCCTGATTCAGTTTTAAGGTATCCACGAAGAAGGGATGCCCATGTCCCAAGGGCCGTTXATGGAAAGGTAAAATGGACTTTC
CCTTTCCGTGTGATTTTCCCGAGTCTTAACCGCAAAACCGTGGCAGAAACCTTTGGGCTTgGGCTGGCCTCCCAACCCCAAATTGGCAGT
ATTTGATTTTGGAATTAAAACAGGTGGGGGAACACTCTTTTGGCCCGTGGTGAACTTTGGAGAXATTAATTTGCAAGAGAACCCCCACCC
TGCCCCAAAAGGCTTTTTGCAAAAGATAGATAATGCCCTGGGGGGGACACAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan